(data stored in ACNUC1104 zone)

EMBL: AP008957.PE243

AP008957.PE243       Location/Qualifiers
FT   CDS_pept        284543..286090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02430"
FT                   /product="putative fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="protein synonym:acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30951"
FT                   /db_xref="GOA:C0ZLX4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLX4"
FT                   /protein_id="BAH30951.1"
FT                   /translation="MNADMMNDEPMAPGLHEQAGYADLILSALRRRPDHIAFRFTDRNG
FT                   DRAELTYRQTAEQIERIAGVLSSLALPDGGGVALLAGPCPEAFTVMAAACLAGVRYTAL
FT                   HPLATEENDRMVLKDSGTDLLLVADGQFQTRAEAAQTRVMSLSALESACELATAGTGSD
FT                   FGGQGRALYLFYTGGTTGEPKGVMLRDRSLVANAWACTTWEWPADTTMLLTTPMSHAAG
FT                   LLVAPGLQRGASFELHRSFDPDRVVDAIENDGVTATFVVPTMLYALLDHPRLSDANLSG
FT                   LNWMLYGAAPIDPTRLAQAGAVFGPILSQHYGQAEAPNALTVLDTREHTDDPAVLGSCG
FT                   RAMPGVEVVLFDEQGNETATGVPGELCVRGPLVMDGYWNKPEQTAAALANGWLHTGDVA
FT                   RIDETGLISIVDRIKDTIISGGFNVYPREVEDSLGHHPAVAACAVFGVPDPQWGEAVTA
FT                   AVVLKTGWSVTPEQLVAHVRSHKGPIWAPKEISILEALPLTALGKVDKKALRGASQT"
     atgaacgcgg acatgatgaa cgatgaaccg atggcgccag gcttgcacga gcaagcggga        60
     tatgcggatc tgattctgtc ggcgctgcga cgccgaccag accacatcgc gtttcgattc       120
     acggatcgga acggtgatcg ggccgagctg acatatcggc agaccgcgga acagatcgag       180
     cggattgcag gtgtcctcag tagcctcgct ctgccggacg gaggcggggt agccctgctt       240
     gcgggtccgt gtcctgaagc attcacggtc atggcggcag cgtgtctggc gggcgtgcgc       300
     tacacggcac tccatccgct cgcgaccgaa gagaacgaca ggatggtgct gaaagacagt       360
     ggtaccgatc tcctgttggt tgccgacgga cagttccaga cgcgcgccga agcggcgcag       420
     actcgagtga tgtcactgtc agccctcgaa tcagcgtgtg aattggctac ggcgggaaca       480
     ggttcagact tcggcggtca gggtcgagct ttgtatctct tctacaccgg tggaactacc       540
     ggtgagccga agggcgtcat gctcagggac cgatctttgg tcgccaatgc ctgggcctgc       600
     accacgtggg agtggccggc tgataccacc atgctgctca ccacgccgat gtctcatgct       660
     gccggtctgc ttgtcgcacc cggtctgcag cgaggtgcaa gcttcgagtt gcacaggtcg       720
     ttcgacccgg acagggttgt cgacgcaatc gaaaatgacg gagtcacagc tacattcgtc       780
     gttcctacga tgctctacgc cttgctcgac catccacgcc tgtcggatgc gaatctgtcc       840
     gggctgaact ggatgcttta cggtgctgca cccatcgacc ccaccaggct cgcgcaggca       900
     ggggcggtgt tcgggccgat cctgagccag cactacggtc aggccgaagc cccgaatgcg       960
     ttgacggtgc tcgatacacg tgagcacacg gacgatcccg cagttctggg gagttgtggg      1020
     cgcgcgatgc caggtgtcga agtggtgttg ttcgacgagc agggaaacga gaccgcgacg      1080
     ggcgtacccg gcgagctttg tgtgcgaggt ccgctcgtga tggacggcta ttggaacaaa      1140
     cctgaacaaa ccgctgcagc gctcgcgaat gggtggttgc acaccggcga cgttgctcgg      1200
     atcgacgaaa ctgggctcat ctcgatcgtc gaccggatca aggacacgat catcagtggt      1260
     ggattcaacg tctacccgcg cgaagtcgag gactcactcg gacatcatcc cgcagtggcc      1320
     gcctgtgcag tattcggtgt ccccgatcct caatggggag aagcggttac cgcggcagtc      1380
     gtactgaaga cgggatggtc ggtcacgccc gagcaactcg tcgcacacgt cagatcacac      1440
     aagggcccga tctgggcgcc caaggagatt tcaattctgg aagcgttgcc gctcactgct      1500
     ttggggaagg tcgacaagaa ggcactccga ggcgcttcac agacctag                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page