(data stored in ACNUC1104 zone)

EMBL: AP008957.PE244

AP008957.PE244       Location/Qualifiers
FT   CDS_pept        complement(286079..286939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30952"
FT                   /db_xref="GOA:C0ZLX5"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLX5"
FT                   /protein_id="BAH30952.1"
FT                   /translation="MTTVLLLTCDGAAREADVESKLVMEALTSYGIASTMAPWSSRSLL
FT                   DIDADLVLIRSTWDYTQRLDEFLAVLDQLTAPIANPLPIVEWNAHKGYLTELAAAGVPI
FT                   VPTAVIAAGKSETLTLPSFEGADVIVKPAVSAGAVGVGKFAAGSEQAHAHLSSILERGN
FT                   DALVQPFISDVVDGERSIIHLGGRYSHAVRKIPATNDFRVQEFHGGTNFLHEPSAAELA
FT                   VADAALAATPCGPGELLYARVDVVGPVDQPLLMEVELIEPELFLPFAPGSADSLARAVV
FT                   ASLGL"
     atgaccacgg ttctcctgct cacctgtgac ggcgccgccc gcgaggcgga tgtcgaaagc        60
     aaactcgtca tggaagctct cacctcctac ggcatcgcgt cgacgatggc gccgtggtcg       120
     agccggtccc tcctcgatat cgacgccgac ctggttctga tccggtcgac ctgggactac       180
     acccagcgcc tcgacgaatt tcttgccgtt ctcgatcagc tgaccgcccc gatcgccaac       240
     ccgctcccga tcgtcgagtg gaacgcccac aagggatacc tgaccgaact tgccgcggcc       300
     ggcgtcccca tcgtcccaac cgctgtgatc gctgccggaa agagcgaaac actcaccctc       360
     ccttcgttcg agggtgccga cgtcatcgtc aagcctgcag tgtccgccgg cgctgtcgga       420
     gtgggaaagt ttgccgccgg gtccgaacag gcccacgctc acctcagctc gatcctcgag       480
     agaggcaacg acgctctggt ccagcccttc atctcggatg tcgtagacgg cgagcgctcg       540
     atcatccacc tcggtggacg ctactcccat gccgtccgta agatcccagc caccaatgac       600
     ttccgtgtgc aggagttcca cggcggaacc aacttcctcc acgagccttc cgccgccgaa       660
     ctcgcggtgg ccgacgcggc actggccgcg accccatgcg gccccggcga attgctttat       720
     gcgcgtgtgg acgtcgtggg gccggtggat caaccactgc tcatggaagt ggaattgatc       780
     gagcccgaac tcttcctgcc cttcgccccc ggatctgccg actccctcgc acgtgcagtt       840
     gtcgcgtctc taggtctgtg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page