(data stored in ACNUC1104 zone)

EMBL: AP008957.PE251

AP008957.PE251       Location/Qualifiers
FT   CDS_pept        complement(292035..292961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02510"
FT                   /product="putative NAD-dependent epimerase/dehydratase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30959"
FT                   /db_xref="GOA:C0ZLY2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLY2"
FT                   /protein_id="BAH30959.1"
FT                   /translation="MNVPTWVVGSGGLLGSSVARELERRGADIRTSRVPWGEPALAREI
FT                   LFADARKLVTDAAGGPWRMAWCAGAGVNGTSSDEFARENQLMKDVLDELGTADAGVGTV
FT                   FHASSAGGVYAGAPGAPHTETSATNPLADYGRAKLDAESIVREFGSRSGTRTVIGRFAN
FT                   LYGPGQNLAKPQGLISHLCRGYLLSMPISIYVPMDTLRDYVYVSDAAEMVVDSFTRAEA
FT                   SQEPTVTKIYASGRSVTIGAILGACHTVFRKRPNVVLASSPLASAQARDLRLRSIVWTD
FT                   LDQRTHRPLPAGIASTLDSIRRNLAAR"
     atgaatgtcc ccacgtgggt agtcggcagc ggcggcctcc tcggcagctc cgtggcccgc        60
     gaactcgagc gccgtggggc cgacatccgc accagccgcg tcccgtgggg cgaacccgct       120
     ctggccagag aaatcctgtt cgccgatgcc aggaaactgg ttactgacgc cgccggcggc       180
     ccgtggcgaa tggcgtggtg cgccggtgca ggtgtgaacg gtacgagcag tgacgaattc       240
     gctcgcgaga accaactcat gaaggacgtt ctcgacgagc tggggacggc ggacgcaggc       300
     gtcgggaccg tcttccatgc ttcgtctgcc ggcggcgtct acgccggagc tcccggagca       360
     ccgcacaccg aaacaagcgc gaccaatcca ctggccgact acgggcgagc aaagctcgat       420
     gccgaatcga ttgttcgcga attcggctcc agaagcggaa cccgcactgt cataggaaga       480
     ttcgcaaatc tctacggccc gggtcagaat ctggcgaaac cccaaggcct gatttcgcac       540
     ctctgccgag gctatctgct gtcgatgccc atttcgatct acgttcccat ggacacgctt       600
     cgggactacg tctacgtctc cgacgcggcc gaaatggtgg tcgacagctt cacccgagcg       660
     gaagcgtcgc aggaaccgac ggtcaccaag atctacgcgt ccggacgcag cgtcaccatc       720
     ggggcgatcc tcggcgcgtg ccacaccgtc ttcagaaaac gccccaacgt tgtgctcgcc       780
     agttctccac tcgcttcggc gcaagcccga gacctacggc tgcgatcgat cgtgtggact       840
     gatctggacc agcgcacaca tcgcccgttg cctgccggga tagcgtcgac cctcgactcc       900
     atccgccgca atctggctgc acgctag                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page