(data stored in ACNUC1104 zone)

EMBL: AP008957.PE256

AP008957.PE256       Location/Qualifiers
FT   CDS_pept        complement(298948..299775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30964"
FT                   /db_xref="InterPro:IPR008884"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLY7"
FT                   /protein_id="BAH30964.1"
FT                   /translation="MFERFRSSARTKLQRAVSEVVETADRRNADRTQQILDALALSRDE
FT                   LAEARVDIAGLRSRIDELEFRQRRDLAYAVDLEATASTAEFILEHLRVTDTFGHPHDTL
FT                   RHALGLIEIPGMALEFGVASGTTLRIVAEAFTEREGTVAGFDVFSGLPETWRTGFPVGE
FT                   FAQESIPEVPGAQLVPGLFEDTLPSFLNDESGPVAFLHLDADLYSSTKTVLDLLGDRLV
FT                   PGSIVVFDEFFNYPGWQQHEYRAWTEFVTRTGISFEYLGYTVDNEQVIVEITS"
     atgttcgagc ggttccgttc cagcgccagg accaagcttc agcgtgcggt atccgaggtg        60
     gtcgagaccg ccgaccgtcg caacgccgat cgcacgcagc agatcctcga cgcgctggca       120
     ctctcacgtg acgaactggc cgaggcccgc gttgacatcg cgggcctccg gtccaggatc       180
     gacgagctgg aatttcgcca gcgtcgggat ctggcctacg ccgtggacct cgaagcgacg       240
     gcatcgaccg ccgagttcat cctcgaacac cttcgagtca ccgacacatt cggccaccca       300
     cacgacacgc tgcgccacgc attgggcttg atcgaaatac ccggcatggc actcgaattc       360
     ggcgtcgcca gcggaaccac actcaggatc gtcgcggagg ctttcaccga acgcgagggg       420
     accgtcgcag gtttcgacgt gttctccggc cttccggaga cctggcgcac cgggttcccg       480
     gtcggcgagt tcgcacagga atccatcccc gaagtgcctg gagcgcaact tgttccgggc       540
     ctcttcgagg acaccttgcc ctcgttcctg aacgacgaat ccggccccgt tgcgttcctg       600
     cacctcgacg ccgaccttta ctcgtccacc aagaccgtgc tcgatctcct cggcgaccga       660
     ctggtccccg ggtcgatcgt cgtcttcgac gagttcttca actatcccgg gtggcagcag       720
     cacgagtacc gggcgtggac ggagttcgtc acacgcaccg gcatctcgtt cgaatacctc       780
     gggtacaccg tcgacaacga gcaggtcatc gtcgagatca ccagctga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page