(data stored in ACNUC1104 zone)

EMBL: AP008957.PE26

AP008957.PE26        Location/Qualifiers
FT   CDS_pept        30691..31404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30734"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLG6"
FT                   /protein_id="BAH30734.1"
FT                   /translation="MSSGESSRTVWHIGVLAVCLVAGLMVATAQRSAEENQLQVTESTR
FT                   LSDLVRSAQANAEKVSADRDELAAQLDSLQEDAARSDAGVAAALGDIKNISADAGLTEM
FT                   TGPGVVVTMTDAPRNAEGKYPVDATPDDLVVHQQDVQSVLNALWAGGAEAVGMQDQRII
FT                   STSAPRCIGNTLLLHGRTYSPPYVMSAIGDVARLEAALAAEPGIRIYKQYATRFGLGYT
FT                   QATPSQITVPAYTGG"
     gtgtcttcgg gtgaatcttc acgaactgtc tggcacatcg gtgtacttgc cgtctgcctg        60
     gtagccggtc tgatggttgc cacggcgcag agatccgccg aggaaaacca gcttcaggtc       120
     accgaaagca ccaggctctc cgatctggtc cgcagcgccc aggccaatgc cgaaaaagtt       180
     tcggccgacc gggacgaact tgccgctcag ctcgattcgt tgcaggaaga cgccgctcgg       240
     tccgacgccg gcgtggccgc cgctctcggt gacatcaaga acatctccgc cgacgcggga       300
     ctgacggaga tgaccggccc cggcgtcgtg gtcaccatga cggacgcccc gcgcaacgcc       360
     gaaggcaagt atccggtcga cgccaccccg gacgacctcg tcgtgcatca gcaggacgtc       420
     cagagcgtgc tgaacgcact gtgggccggc ggggccgaag cggtgggcat gcaggaccaa       480
     cggatcatca gtacgtcggc gccgcggtgc atcggaaaca ccctccttct tcacggccgt       540
     acatacagcc cgccgtacgt gatgagtgcg atcggcgatg ttgcgcgcct cgaggcggca       600
     ctcgctgccg aaccgggcat tcggatctac aagcagtacg cgacccgctt cggcctcggg       660
     tacacgcagg cgacgccgtc gcagatcacg gtccccgcct ataccggcgg atag             714
//

If you have problems or comments...

PBIL Back to PBIL home page