(data stored in ACNUC1104 zone)

EMBL: AP008957.PE262

AP008957.PE262       Location/Qualifiers
FT   CDS_pept        304413..305615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30970"
FT                   /db_xref="GOA:C0ZLZ3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR011340"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLZ3"
FT                   /protein_id="BAH30970.1"
FT                   /translation="MAYDVARVRGLIPSLGDGWIHLDPQAGMQIPDAVSRTVSTAFRAS
FT                   ASSSSGRHVSNRRSAAILESARTAVADLVGGDPAGVVLGSDRAVLLAWLAESLSSRLGL
FT                   GTGLVLSRLDEEANVAPWLRVASRYGAQVRWAEVEIETCELPSWQFNDLITSTTRLVAL
FT                   TAASPVVGSAPNVRAAADRLHEFGGLMVVDAVGAAPYAHVDMADLGADIVAVSAPSWGG
FT                   PQVGALVFRDPGLLDRIPAVSLNPYARGAERLEVGGHQFALLSGLTSSIDFLAGLDESA
FT                   TGTRRERLETSISSLQDYQDGLFDHLMRSLAALPNVMVIGGAPTRVPTLSFTLEGMAAD
FT                   KVAAHLADKRIATVSGTHGGSRLLDALGVNDEGGAVTVGLAPYTTRYEINQLVAELGAL
FT                   G"
     atggcttacg acgttgcccg cgtacggggg ttgattccct cactcggtga cggctggatc        60
     cacctcgatc cgcaggccgg aatgcagatc ccggacgccg tctcgcggac ggtctccacc       120
     gcgttccgtg cctctgcgtc ttcttcctcc ggtcgccacg tctcgaaccg tcgtagtgct       180
     gccattctcg agagtgcgcg caccgcggtc gccgatctgg tcggcggaga tcctgcggga       240
     gtcgttctcg gatcagaccg agcggtgttg ttggcttggc tcgccgagtc gctgagttcg       300
     cggttgggcc tcggaaccgg tctcgtgctc tcgcgcctcg acgaagaggc gaacgtcgcg       360
     ccctggcttc gtgtggccag tcgctacggc gcccaggttc gatgggccga ggtcgaaatc       420
     gaaacgtgtg agctcccgag ttggcagttc aacgatctca tcacctcgac gactcgcttg       480
     gtggccttga cggccgcatc accggtcgtc ggttcggctc cgaacgtccg cgccgcagct       540
     gatcgtctgc acgaattcgg cggactgatg gtggtcgacg ccgtcggcgc agcgccatat       600
     gcgcatgtgg acatggctga tctcggggcg gacatcgttg ccgtcagcgc gccgtcgtgg       660
     ggcggtccac aggtgggcgc actcgtcttc cgcgatcccg gactgctcga ccgaattccg       720
     gccgtgtcgc tcaacccgta cgcgcgtggt gccgagcgac tcgaggtggg cggtcatcag       780
     ttcgcgctgc tgtccggtct cacgtcgtcg atcgatttcc tggcgggctt ggacgaatcg       840
     gcaacgggaa ccaggcgtga gcgcctcgaa acctcgatca gctcgctgca ggactaccag       900
     gacggtctgt tcgatcacct catgcgttct ctcgcagccc tgcccaacgt gatggtgatc       960
     ggcggcgcac ccacgcgggt gcctacgctc agcttcacac tcgaggggat ggcggcagac      1020
     aaggtcgccg cgcacctggc cgacaagcgc atcgcaacgg tcagcggtac gcatggtggt      1080
     tccaggctgc tcgacgccct cggtgtcaac gacgaaggcg gcgcggtcac cgtcggcctt      1140
     gcgccgtaca cgacgcggta cgagatcaat cagctggtcg ccgaactcgg cgccctgggc      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page