(data stored in ACNUC1104 zone)

EMBL: AP008957.PE266

AP008957.PE266       Location/Qualifiers
FT   CDS_pept        309250..309933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02660"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30974"
FT                   /db_xref="InterPro:IPR015286"
FT                   /db_xref="InterPro:IPR036435"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLZ7"
FT                   /protein_id="BAH30974.1"
FT                   /translation="MATELKARTSRRRSRAAVGLAACAVAALSSGVVFAGSASATPTAL
FT                   SDKFASTVTDDGWSLDLAATKLSANPVPNLATTAFTREGFVSAKVTGTIGGAGDSAVKT
FT                   GYVEQGLQIGCQIDVSSGLGLGLGFSLGPSVGVSISGVPSANVGVNASVNPSIQSTIAP
FT                   GTITTIPLGKKDLESSKASITAENVHVKVDACMGPVTIRSYAQLSVSTATSDNTLFVYS
FT                   DPTWL"
     atggcaaccg aattgaaagc acgaacatct cgccgtcgat cgagggccgc ggtagggctc        60
     gcggcgtgtg cggttgccgc gctgtcgtct ggtgtggtct tcgcagggag cgcatcggca       120
     acgccgacgg cgttgtcgga caaattcgcg agcacggtca ccgatgacgg ctggtcgttg       180
     gatcttgccg ccacgaaact gtcggcgaac ccggtgccga atctggcgac gacggcgttc       240
     acccgtgagg ggttcgtgtc ggcgaaggtg accggcacga tcggtggtgc gggcgattcg       300
     gcggtgaaga ccggttatgt cgagcaggga ttgcagatcg gctgccagat cgatgtttcc       360
     tccggacttg gcttggggct tggtttttcg ctcggccctt ctgtcggtgt gagtatttcg       420
     ggtgtcccgt cggcgaacgt gggtgtgaat gcgtcggtga atccgagtat tcagtcgacg       480
     attgcgccgg gcacgatcac gacgattccg ttggggaaga aggatctcga gtcgtcgaag       540
     gcgtcgatca cggcagagaa cgtgcacgtg aaggttgatg cgtgcatggg gccggtgacg       600
     atccgctcgt atgcacaact ctcggtgtcg acggcgacgt cggataacac gttgttcgtg       660
     tactccgatc cgacctggct ctag                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page