(data stored in ACNUC1104 zone)

EMBL: AP008957.PE269

AP008957.PE269       Location/Qualifiers
FT   CDS_pept        310881..313247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30977"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM00"
FT                   /protein_id="BAH30977.1"
FT                   /translation="MKSVLKLRRSIAGALAAGALLTGVAGVIGAGIALTAGPATAGPAE
FT                   DCAAVRARDHQIYLNLIASLPPGAPVPPEYINPCLSAPTTTPTAAPTTTVGLPGAQAPG
FT                   GGPNVGANAPTNFPAYNGTPIVPVPGAALPGQPNTPTPSGIENPAGVPVPTTTSGPAPT
FT                   TPQPAGSTAPTAVPDRGPGPVPSGTPNSAPGQSESNPTVTPSGLDKGDGRDRYLELVLV
FT                   GAAAFTAGGIGVRGRRSPFGPRIPLGGRTPESILSQTVGTLASPLMQYVKGGQSKITVT
FT                   EPGGGRRTFFLIHDATSSHEAEIPVDVPPGGHMSVNPDGSVTVFDADGNPISVVAAPWA
FT                   YDANGNPVPTDYEVRDGRLIQTVYADEATAYPILADPPEKKAKAPTSVASKQVQKNTNT
FT                   AAPKPNSMTSRTSPQKPQNSGNTNSSNTSGATNSGTTAGKCAGITTQGSAPVTKPASPN
FT                   QSPRTTTKPGPKPAPTSQEQATNQLAQAHGEVPPVAPSKPAQPNQSPRTTTSPGPKPTV
FT                   SPRQQAANQLAEAHGDVPAGFTGNVPIPPDPNAPDDRSFPQKVWDTAWGVGESAVDTTV
FT                   DSVGTLGDAWRNFLVVPVHDAAVDPFGFNRGQRAQPSPEHSPAEIAAAAANIVSLIPIV
FT                   GTGGRVGGAAVQEAVEAVLRRGGTAADAEAAGRRAAATAGEAGNRAPSDPTIPVGDRPA
FT                   STPVGGRGDREINVKPGTNRPGIVNGREYTGHAFDRMQERGILPSLVEQAIREGVATPS
FT                   RGNTTVIYDSINNLSVIINETGRVVTTSFGNLSGK"
     gtgaagtccg tgctgaagct gcgcaggtcc atcgcgggag cactcgccgc cggagcactg        60
     ttgaccgggg tggcgggggt gatcggtgcg ggaatcgcgc tgaccgctgg acctgcgact       120
     gcgggaccgg cggaggattg cgcggcggtg cgggcacgtg atcatcagat ctacctgaac       180
     ctgatcgcgt cactgccacc cggtgccccc gtcccgcccg agtacatcaa cccgtgcctg       240
     agcgcaccca ccacgactcc gacggcggcc ccgacaacca ccgtcggact accgggtgca       300
     caggctccgg gcggtggccc gaacgtcggc gcgaacgcgc cgacgaactt ccccgcttac       360
     aacggcaccc ccatcgtccc cgtccccggc gccgcgctgc ctggacagcc gaatacgccg       420
     acaccatctg gtatcgagaa ccctgcagga gtcccggttc cgacgaccac cagcggacct       480
     gccccgacca caccccaacc cgctggatcg accgcaccca cagcggtccc cgatcgtggt       540
     cccggacctg ttccctctgg aacgccgaat agtgctcccg ggcaatcgga atcaaatccc       600
     acggtcaccc cctcggggct cgacaaaggc gacggccgtg accggtacct cgaactcgtg       660
     ttggtcggtg ccgccgcatt cacagccggc gggatcggag tacgtgggcg tcgttcaccg       720
     ttcggcccac gcataccgtt gggtgggcgt acgccggaat cgatcctctc ccagacagtc       780
     ggtaccctcg cctcaccgct gatgcagtac gtcaagggtg gccagtcgaa gatcacagtc       840
     accgaacccg gcggaggacg tcgtacgttc ttcctcatcc acgacgcgac gtcctcacac       900
     gaagcggaaa tccccgtcga cgtcccgccc ggcgggcata tgagcgttaa tccggacggc       960
     tcagtcaccg tcttcgacgc ggacggaaac ccgatctcgg tcgtcgcagc tccgtgggcg      1020
     tacgacgcca acggcaatcc tgttcccacc gactacgaag ttcgcgacgg ccgcctgatt      1080
     cagacggtgt acgccgacga agcgaccgcg tacccgattt tggctgatcc gccggaaaag      1140
     aaggcgaaag cacccacctc tgtcgcttcg aaacaagtcc agaaaaatac gaacaccgcc      1200
     gcacccaagc cgaattcgat gacctcgcgc acaagtccgc agaaaccgca gaacagtgga      1260
     aacacgaact cgagcaacac ttccggagcc acgaacagcg gcaccaccgc tggtaagtgc      1320
     gccgggatca ccacccaagg ctccgctccg gtcacgaaac ctgcatctcc caatcagtca      1380
     ccgcgcacca ccaccaaacc tggaccgaag cccgcgccga cctctcagga acaagcaacg      1440
     aaccaactcg cccaagcaca cggcgaagtc cctccggttg caccttcgaa acccgcgcaa      1500
     ccaaatcagt cgccacgcac cacaaccagt ccgggcccca aacccactgt cagtccacgt      1560
     caacaagctg cgaaccagct tgccgaagcg cacggggacg tgcctgccgg gttcaccggc      1620
     aatgtgccga tcccgccaga tccgaacgcg cccgacgacc gatcgttccc gcaaaaagta      1680
     tgggacaccg cgtggggtgt cggggaaagt gccgtcgaca caacagtcga tagcgtcgga      1740
     acgctcggag atgcgtggcg aaacttcctc gtagtccccg tgcacgatgc cgccgtcgat      1800
     ccgttcggct tcaatcgcgg ccaacgagca caaccttcac ccgagcattc tccggctgag      1860
     atcgctgccg cagcagcaaa tatcgtctcc ctcattccga tcgtaggcac aggaggcaga      1920
     gtcggcggag ctgccgtgca agaagcggtg gaggctgttc tgcggcgcgg cggaaccgcc      1980
     gcagacgccg aagccgcagg tcgcagggca gccgccaccg ccggtgaggc cgggaataga      2040
     gcccctagcg atccgactat tcccgtcgga gacagaccgg cctcgacgcc tgtgggtggg      2100
     cgcggagatc gcgaaataaa tgtaaagccc ggaaccaatc gtcctggaat agtcaacggt      2160
     cgtgaatata cggggcatgc gttcgaccga atgcaagagc gcggcatact cccatccctg      2220
     gttgaacagg ccattcgtga aggggtggcg accccgagca gaggaaacac gaccgtgatc      2280
     tatgattcga taaacaacct atcagttatc atcaatgaaa cgggcagagt tgtgaccacc      2340
     tcatttggca atttatcggg aaagtga                                          2367
//

If you have problems or comments...

PBIL Back to PBIL home page