(data stored in ACNUC1104 zone)

EMBL: AP008957.PE275

AP008957.PE275       Location/Qualifiers
FT   CDS_pept        318468..319151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02750"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30983"
FT                   /db_xref="InterPro:IPR015286"
FT                   /db_xref="InterPro:IPR036435"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM06"
FT                   /protein_id="BAH30983.1"
FT                   /translation="MSIESQNGVSHRRSRAAVGLAACAVAALSSGVVFAGSASATPTAL
FT                   ADKFASTVTDDGWSLDLAATKLSSNPVPNLATTAFTREGFVSAKVTGTIGGQGDSAVKT
FT                   GYVEQGLQIGCQIDVSSGLGLGLGFSLGPSVGVSISGVPSANVGVNASVNPSIQSTIAP
FT                   GTITTIPLGKKDLESSKASITAENVHVKVDACMGPVTIRSYAQLSVSTATSDNTLFVYS
FT                   DPTWL"
     atgtcgatcg aatcgcaaaa cggcgtatcc catcgtcgat cgagggccgc ggtagggctc        60
     gcggcgtgtg cggttgccgc gctgtcgtct ggtgtggtct tcgcagggag cgcatcggca       120
     acgccgacgg cgttggcgga caagttcgcg agcactgtca ccgatgacgg ctggtcgttg       180
     gatctcgccg cgacgaaact gtcgtcgaac ccggtgccga atctggcgac gacggcgttc       240
     acccgtgagg ggttcgtgtc ggcgaaggtg accggcacga tcggtggtca gggcgattcg       300
     gcagtgaaga ccggatatgt cgagcagggg ttgcagatcg gctgccagat cgatgtctcc       360
     tccggacttg gcttggggct tggcttttcg ctcggcccgt ctgtcggtgt gagtatttcg       420
     ggtgtcccgt cggcgaacgt gggtgtgaat gcgtcggtga atccgagtat tcagtcgacg       480
     attgcgccgg gcacgatcac gacgattccg ttggggaaga aggatctcga gtcgtcgaag       540
     gcgtcgatca cggcagagaa cgtgcacgtg aaggttgatg cgtgcatggg gccggtgacg       600
     attcgctcct acgcacaact ctcggtgtcg acggcgacgt cggacaacac gttgttcgtg       660
     tactccgatc cgacctggct ctga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page