(data stored in ACNUC1104 zone)

EMBL: AP008957.PE276

AP008957.PE276       Location/Qualifiers
FT   CDS_pept        319209..319640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30984"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM07"
FT                   /protein_id="BAH30984.1"
FT                   /translation="MVTHHAHKGEIMKIRTLATAGTLTAGIALFGVLGAGVASAATPIV
FT                   EPEQGRIGLSLSNAETAALAASPIPDAISDIVPGSQRWIELAPGSALTVGPDGKLSAPD
FT                   RVVIGEAAAHAGGYVDVYLADPNNPANAGYVTLTYQYWN"
     gtggttactc atcacgccca caaaggagaa atcatgaaga ttcgtacctt ggccactgcc        60
     ggaaccctca ccgcgggtat cgccctgttc ggtgttctcg gcgcaggcgt ggcatctgct       120
     gcaactccga tcgtcgaacc tgagcagggt cggatcggtc tgtcgctctc gaatgcggaa       180
     accgcggcgt tggcggcgag cccgatcccg gacgccatct ccgacatcgt tccaggctcg       240
     cagcggtgga ttgagctcgc accgggctcg gcgctcaccg tcggccccga tggcaagctc       300
     agcgcccccg accgcgtagt gataggcgaa gccgctgccc atgctggtgg ctacgtcgat       360
     gtctacctgg ctgatcctaa caacccggcc aacgccgggt acgtcaccct gacctaccag       420
     tactggaact ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page