(data stored in ACNUC1104 zone)

EMBL: AP008957.PE277

AP008957.PE277       Location/Qualifiers
FT   CDS_pept        319826..320041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30985"
FT                   /db_xref="GOA:C0ZM08"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM08"
FT                   /protein_id="BAH30985.1"
FT                   /translation="MIATAVGLGLLIAAFAVIGKLAGWANDYGTILVYLAFFLWMSISG
FT                   RLFWWGADKLIALLRTKKSDNRGAHR"
     gtgatcgcta cggcagttgg actggggttg ctgatcgcgg cattcgcggt gatcgggaag        60
     ctcgccggct gggcgaacga ctacgggacg atcctggttt acctggcgtt cttcttgtgg       120
     atgtcgatct ccggacggtt gttctggtgg ggcgcagaca aactcatcgc gctactccga       180
     acgaagaaga gtgacaatcg tggtgcgcac cggtga                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page