(data stored in ACNUC1104 zone)

EMBL: AP008957.PE280

AP008957.PE280       Location/Qualifiers
FT   CDS_pept        324921..325538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30988"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM11"
FT                   /protein_id="BAH30988.1"
FT                   /translation="MHRRAKLASVLEGIDGLAMATPRKVRGSAWERVLKAAASNLGPEW
FT                   VVARSGTQGELIHLPVRWWFNSIGLDPKPNREELTFSHVPLMREFTPGTITFRQSSYQP
FT                   GPTDSGPPNMQMDIFDTRGAAEIVRWWALGPSTKFFAAPPLPDSVAAAEQAYADRKEEP
FT                   CRDWMISAGLRVIADTGSPIEVIDSVLWELARRDVGGHVQSF"
     atgcaccgga gagcgaagtt ggcttccgtc ctcgagggaa tcgatggctt ggccatggcg        60
     accccgagga aggtgcgcgg ttctgcatgg gagcgggtgt tgaaggctgc ggcgagcaac       120
     cttggcccag agtgggttgt ggcacgatct ggcacccagg gggagttgat ccatctacca       180
     gtgcgatggt ggttcaattc cattgggttg gatcccaaac cgaaccggga agagttgacc       240
     ttcagtcatg tgcccctgat gagagaattc acgccgggca ctatcacctt tcgacagagt       300
     tcatatcaac ctggtcccac agattctgga ccaccgaaca tgcagatgga catcttcgat       360
     acccgcggtg ctgcggagat cgtgcgctgg tgggcgctcg gtccgtccac caagttcttt       420
     gctgcaccgc cgcttcccga ctcggtagct gcagccgagc aggcttatgc cgaccgcaag       480
     gaagagcctt gccgggattg gatgatttcg gctggcctgc gggtgatagc tgacaccggt       540
     tcgccaatcg aggtcatcga cagcgtcctc tgggagttgg ctcgccgtga cgtcggtggc       600
     cacgtccaaa gtttctga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page