(data stored in ACNUC1104 zone)

EMBL: AP008957.PE281

AP008957.PE281       Location/Qualifiers
FT   CDS_pept        325804..326640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30989"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM12"
FT                   /protein_id="BAH30989.1"
FT                   /translation="MASMHMSDDKPKPPKSVTEVLESLGMDRDQLREMAKDAIADLTPK
FT                   KGRGAAWEKVLGAAVEKLGPNWTIIGSGLRAKLLHTPVRWFFDTVGIDPIPNREKLTIT
FT                   HLPLIEPLDPGTLTEWQDHYDSRHSGHDYHGRQIDIFDTVSAAELVIWWAEGPASDLFD
FT                   ARSVEALTPLREKQYLERSQSGPARWTILAGLRVITDTGSPLEVIDNAIEYFRGRVADP
FT                   KAPLVMFWTQFREVAAAGDRERTLWWLDEHRRATVREHYPLPDSVFADVLEDLGDG"
     atggcaagca tgcacatgag cgatgacaag cctaagccac cgaaatcggt cactgaggtc        60
     cttgagtccc tgggaatgga ccgggatcaa ttgcgggaga tggcgaaaga tgcgatcgca       120
     gacttgactc cgaaaaaggg gagaggcgct gcgtgggaga aggtgttggg agcggcggtt       180
     gagaagctcg ggccgaactg gacgatcatc gggagcgggt tgcgagccaa gctgctgcac       240
     actccggtgc gatggttttt cgacaccgtc gggatcgatc cgattcccaa ccgtgagaaa       300
     ctgacgatta ctcacctacc actcatcgaa cccctcgatc ccggaacact cactgagtgg       360
     caggaccact acgacagcag gcatagcgga cacgactacc atggccgcca gattgatatc       420
     tttgataccg tctccgctgc cgagctagtg atctggtggg ctgaggggcc agcatccgac       480
     ctgttcgacg cacgatcggt ggaggcactc accccactcc gtgagaagca gtaccttgag       540
     cgcagtcagt cgggtccagc acgctggaca atcttggcgg ggctgcgtgt gatcactgac       600
     accggttcac cgctcgaggt tatcgacaac gcaattgaat acttccgcgg ccgggttgcc       660
     gacccgaaag ctccacttgt gatgttctgg acgcagtttc gtgaggtcgc tgctgccggt       720
     gatcgagaga ggacactgtg gtggctcgac gagcatcgac gtgccacggt gcgtgagcac       780
     tacccgttac cggattcggt gttcgccgac gttctcgaag acctgggcga cggctag          837
//

If you have problems or comments...

PBIL Back to PBIL home page