(data stored in ACNUC1104 zone)

EMBL: AP008957.PE284

AP008957.PE284       Location/Qualifiers
FT   CDS_pept        327337..328206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30992"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM15"
FT                   /protein_id="BAH30992.1"
FT                   /translation="MSFFGRRPTVAGYWGTRVQSSQEVAQTMRAFLDDLEAIDPELALS
FT                   LVSTAEFDKVPADLSVDGLVRIFEHSRSKEMGYSDTPGPGYDIDLSPEDGTARRVGAWV
FT                   GGLETSAPNSVLVSLPTETQLTDSTRRLLDPDIGDAIMRVIVKHWEPERARWSIGDYRH
FT                   LQNRSKGEVEVGWETYFHSGVTFDRSALPQSAVVEELPTGTLIRLGDKPMQVDAADIVA
FT                   VRAALGYPVQAPQWVRSSPLHQMSRNVLTGWPASPFDSIVRWHSEPTCSRGSSIRIQRF
FT                   GGRWSAIC"
     atgagctttt tcgggcgacg gccgacggta gccggatatt ggggcacgcg ggtgcagtcg        60
     agtcaggaag tggcgcagac gatgcgcgct ttcctcgacg atctggaagc gatcgacccg       120
     gagttggcgt tgtcgttggt ctcgactgcc gagttcgaca aggtgccagc agatctcagt       180
     gtggacgggt tggtgcgaat cttcgagcat tcccgctcga aggagatggg gtattcggac       240
     accccgggac cgggctacga catcgacttg tcgccggaag atgggaccgc gcgccgggtc       300
     ggtgcctggg tcggcgggct ggaaaccagt gctcccaaca gtgtcctggt gtcgttgccg       360
     acggagacgc agctcaccga cagtacccgg cggttgctcg acccggatat cggagacgcg       420
     atcatgagag tgatcgtcaa gcattgggaa ccggagcgag ctcggtggag catcggagac       480
     taccggcacc ttcagaatcg gtcgaaaggt gaggtcgagg tgggatggga aacgtacttc       540
     cattccggag ttacgttcga tcgcagcgcg ctgccccaat ctgcggtggt agaggaactg       600
     cccactggca cgttgattcg gttgggggac aagcctatgc aggttgatgc cgccgacatt       660
     gtggcggtgc gggcggcgtt gggttacccg gtgcaggccc cgcaatgggt ccggagttca       720
     ccattgcatc agatgtcgag aaatgtgtta accggatggc ctgcttcgcc tttcgatagt       780
     atcgtcagat ggcactccga accgacttgc tcgcgtggct cctcgattcg gatccagcga       840
     ttcggtggca ggtggagcgc gatctgttga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page