(data stored in ACNUC1104 zone)

EMBL: AP008957.PE286

AP008957.PE286       Location/Qualifiers
FT   CDS_pept        328768..329121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30994"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM17"
FT                   /protein_id="BAH30994.1"
FT                   /translation="MLQRGLFRRLSTGEPVGPWVGRFAYPFRWRYNVLNAADYFREASL
FT                   SYGNEPDPRMADAIEMIRVARASDGTWLQAGRQPGRVWFEVDTEAGEPSKWLTLSGIRV
FT                   LAWWDQSSPLGSA"
     ttgctgcagc gcggtctgtt ccggagactc tcgaccgggg aaccggtggg gccctgggtc        60
     ggccggttcg cgtacccgtt ccggtggcgt tacaacgtgc tcaacgcagc cgactacttc       120
     cgtgaagcgt cgttgtcgta tggaaatgag cctgatccgc gaatggcgga cgcgatcgag       180
     atgatccggg tcgctcgagc ctcggatggg acgtggctcc aggccggtcg ccaaccgggg       240
     cgggtgtggt tcgaggtcga cacagaggcg ggggagccgt cgaagtggct gactttgtcc       300
     ggcatccgag tgctcgcctg gtgggatcaa tcctcccctc taggttctgc ataa             354
//

If you have problems or comments...

PBIL Back to PBIL home page