(data stored in ACNUC1104 zone)

EMBL: AP008957.PE300

AP008957.PE300       Location/Qualifiers
FT   CDS_pept        341466..342269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31008"
FT                   /db_xref="GOA:C0ZM31"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM31"
FT                   /protein_id="BAH31008.1"
FT                   /translation="MATSIDLVADLGEGFGTWTMGADDALLDTLTSANIACGFHAGDPR
FT                   TMDATVRGCVSRGIGIGAHPSFPDLAGFGRRAMDLSENEVRTDVLFQLGALHAFAVANG
FT                   TSLSHIAPHGKLGNLVAVRQDYARAVVDAVTAFDPSLIVLAQDGALADEATARGLCVGI
FT                   VGIADRAYNSDGTLVARSEPGAVIHDVDVLVERTVRMVVEEVVEAVDGTLIPVVADTVL
FT                   VHGDNPGAVANAKAIRAALEAAGVTIAPLAQVVASRRARDVGCSA"
     atggcaacca gcatcgatct tgtcgccgat ctcggcgaag gattcggcac gtggaccatg        60
     ggcgccgacg atgctctgct cgacacgctg acttcggcca acatcgcttg tggattccat       120
     gcaggcgatc cacgaaccat ggacgcgacc gttcgggggt gcgtatcccg cggtatcgga       180
     atcggcgcgc atccgagttt tccggacctc gccggattcg gccgtcgcgc gatggatctc       240
     agcgagaacg aggtccgaac cgacgtgctg ttccaactcg gcgcccttca tgcctttgca       300
     gtcgcgaacg gaacgtcgtt gtcgcacatc gctccccacg gcaagctcgg gaatcttgtt       360
     gccgtacgcc aggattacgc ccgcgccgtc gtcgatgcgg tcacggcctt cgatccgtcg       420
     ttgatcgtgc tcgcccagga cggggcgttg gccgacgagg cgactgcccg cggattgtgc       480
     gtcggcatcg tcggaatcgc ggatcgcgca tacaactccg acggaactct cgtggcccgc       540
     agcgagccgg gagcagtgat tcacgatgtc gacgttctgg tcgaacggac cgttcggatg       600
     gtggtcgagg aagtcgtcga agctgtggac ggcacgttga tcccggttgt cgccgacacg       660
     gtcctcgtgc acggtgacaa ccccggtgcc gtcgcgaacg cgaaagcgat tcgcgccgcg       720
     cttgaggccg ccggtgtcac cattgcgccg ctggcccagg tcgtggcgtc acggcgggcc       780
     cgtgatgtcg ggtgttccgc gtga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page