(data stored in ACNUC1104 zone)

EMBL: AP008957.PE308

AP008957.PE308       Location/Qualifiers
FT   CDS_pept        complement(349400..349804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31016"
FT                   /db_xref="InterPro:IPR025355"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM39"
FT                   /protein_id="BAH31016.1"
FT                   /translation="MGAWGSGPFDNDGAGDLIASIGHGDFTFESVEWAFEDDYLEVDGG
FT                   QIAVALLELVLIVRADRKRDPAAQDLDLDSFTSALTSERLTWLIEMVERTISSTDSELF
FT                   ELWDEQGPEELASWRVPVVDGLEDLRVLSV"
     gtgggcgcgt ggggatcggg accgttcgat aacgacggtg caggggattt gatcgcgtcc        60
     atcggacacg gtgacttcac cttcgaatcg gtggagtggg cattcgagga cgactacctc       120
     gaggtggacg gcggccaaat cgccgtcgcc ttgctcgaat tggtgttgat cgtgcgcgcc       180
     gatcgcaaac gcgaccccgc cgcccaggac ctcgatctcg attccttcac ctcggccctg       240
     accagcgaac ggctcacctg gctgatcgag atggtggagc gcaccatctc ctcgaccgat       300
     tcggaactgt tcgaactgtg ggacgagcag ggaccggaag agcttgcgtc gtggcgagtt       360
     cccgtcgtgg acggtctcga ggatctgcgc gttctgtcgg tctga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page