(data stored in ACNUC1104 zone)

EMBL: AP008957.PE311

AP008957.PE311       Location/Qualifiers
FT   CDS_pept        complement(351881..352750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31019"
FT                   /db_xref="InterPro:IPR003226"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM42"
FT                   /protein_id="BAH31019.1"
FT                   /translation="MIIATHNGKFHADDVFGVSLLKQLYPDATVVRSRDESVLDSADIV
FT                   LDVGGRYNPAEGRFDHHQRDAGERSNGILYSAFGLLWQEYGLQFCEGDASVFRRIDSRL
FT                   VEGIDAVDNGQEIYTLNDYGTKPFDLSSVLDLFNPISSTDEEFDTQFELAVVLATQVLI
FT                   RLRAKYAGDAAAEREFTETYEKATDPRFVVLERFVPHGRAASAQPELLFTIFPNTNGGW
FT                   SIQTVKPADSKFGSRKLLPEPWRGLNGSDLAAETGVDSSVFCHKAGFIAAAQTRDGALQ
FT                   LLELALAE"
     gtgatcatcg cgacccataa cggcaagttc catgcagacg acgtcttcgg cgtatcgctg        60
     ctcaagcagc tgtaccccga cgccaccgtc gttcgcagcc gtgacgagtc cgtcctcgac       120
     agtgcggaca tcgtgctcga cgtcggcggt cgctacaacc cggccgaggg tcgcttcgac       180
     catcatcagc gcgatgccgg cgagcgcagc aacggcatcc tgtactccgc tttcggtctg       240
     ctctggcagg aatacggcct gcagttctgc gaaggcgacg cctccgtttt ccgccgaatc       300
     gacagtcgtc tggtcgaggg catcgacgcc gtcgacaacg gccaggagat ctacaccctc       360
     aacgactacg gcaccaagcc ttttgatctg tcgtcggtgc tggacctttt caatccgatc       420
     tcgtccaccg acgaggagtt cgacacccag ttcgagctgg ccgtggttct cgcaacgcag       480
     gtcttgattc gcctgcgcgc caagtacgcc ggcgacgctg cggccgagcg cgagttcacc       540
     gagacctacg agaaagcaac ggatccgcgc ttcgtcgtgt tggaacgctt cgttccccac       600
     ggccgcgccg cgtcggccca gccggagctc ctgttcacca tcttcccgaa caccaacggc       660
     ggctggtcga ttcagacggt caagcctgct gactccaagt tcggttcacg aaagctgttg       720
     ccggagccgt ggcgcggcct gaacggctcg gaccttgccg ccgagacggg cgtcgacagt       780
     tcggtcttct gccacaaggc tgggttcatc gcggctgcgc agacccgtga cggcgccctc       840
     cagttgctcg aactggcact ggccgagtag                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page