(data stored in ACNUC1104 zone)

EMBL: AP008957.PE314

AP008957.PE314       Location/Qualifiers
FT   CDS_pept        355721..356440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31022"
FT                   /db_xref="GOA:C0ZM45"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM45"
FT                   /protein_id="BAH31022.1"
FT                   /translation="MSEIFRATAYLRGAEGEVATAVPLTVVEPDGPTRGGIVVLHEARK
FT                   FSPALLNLMCALAGEGWVSVAPHLFHREPEHIQGEVFGDNLFADFDATLDWLVGREVLA
FT                   DTIGVLGFDDAGTAAMLVATSRPVGAAVSVAARGIVEALSVDAQALVDAATSLQAPWLA
FT                   LYGEDDPSTPREHVTLLREATAKADVATLVVSYAGLAHRADEPPQLSEDADLDDPDSAS
FT                   IIEAQTRIFDWFDSHLR"
     atgtcggaaa tcttccgagc caccgcgtat ctgcgcggag ccgaagggga ggtcgccacg        60
     gctgttccgc tgaccgtggt ggagccggac ggcccgacgc ggggcgggat cgtcgtcctg       120
     catgaagccc ggaagttcag cccggctctg ctgaatctga tgtgcgcgct tgccggcgaa       180
     gggtgggtga gcgtcgcacc tcacctgttt caccgcgaac ccgaacacat tcagggtgag       240
     gtgttcggtg acaacctctt cgccgacttc gacgcgaccc tcgattggct cgtcggacgc       300
     gaagttctcg cagacaccat cggggtgctc ggattcgacg acgccggtac cgccgcgatg       360
     ctcgtggcca ccagccgtcc ggtcggcgcc gcggtgagcg tcgccgcccg gggaatcgtc       420
     gaagccttgt cggtggatgc tcaggcgctt gtcgacgcgg ccacttccct gcaggcgccg       480
     tggctggcgc tgtacggcga ggacgatccc agcacgcctc gcgaacacgt gactctgctc       540
     cgggaagcga ccgccaaggc cgacgtcgcg acactggtgg tcagctacgc cggactggct       600
     caccgggcgg acgagccgcc acagctgtcc gaggacgctg acctcgacga ccctgattcg       660
     gcctcgatca tcgaagctca gacccggatc ttcgactggt tcgacagcca cctgcggtaa       720
//

If you have problems or comments...

PBIL Back to PBIL home page