(data stored in ACNUC1104 zone)

EMBL: AP008957.PE316

AP008957.PE316       Location/Qualifiers
FT   CDS_pept        357904..358938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03160"
FT                   /product="putative iron-siderophore ABC transporter
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31024"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM47"
FT                   /protein_id="BAH31024.1"
FT                   /translation="MRSKRFLAVAAAAVAVALGMTACSSDSSETADGGSAGSGSSSFPV
FT                   TIEHAFGTTTIDAKPERVATVAWANHEVPLALGVVPVGMAAATFGDDNGNGMLPWVEEK
FT                   LDELGAKPPVLFDETDGIDFEAVSDTNPDVILAAYSGLTQEDYDTLSEIAPVVAYPEGP
FT                   WATSWRDVIKFNSMGLGMESEGQELISTIEKEIADEVASHPQLAGKATMFLTHVDTADL
FT                   SQVSFYTANDTRAAFFEDLGLSTPKSVADASTGGEFSKKVSAERVDVFDDVELIVTYGD
FT                   QALVDALKADPLLSQMPAVANNSIVFLNGTGPMGTAANPTPLAISWVLGDYVDLLAGAA
FT                   GKSE"
     atgcgttcaa aacgcttctt ggcggtggcc gcagcagcgg tcgcagtcgc cctcggcatg        60
     acagcgtgca gttccgactc ctcggagacc gccgacggcg gcagcgccgg aagcggatcc       120
     agctccttcc ctgtcacgat cgagcacgct ttcggaacta cgacgatcga cgccaagccg       180
     gagcgagttg ccaccgttgc ctgggccaat cacgaagtgc cccttgctct cggcgtggtt       240
     cccgtcggaa tggcagcggc gactttcggt gacgacaacg gcaacggaat gctgccgtgg       300
     gtcgaggaaa agctcgacga actcggcgcg aagccgccgg tgctcttcga cgagaccgac       360
     ggcatcgact tcgaagccgt ctccgatacg aaccctgacg tcattcttgc cgcgtactcc       420
     gggttgacgc aggaggatta cgacaccctc agcgagattg ctccggtcgt ggcatacccc       480
     gaggggccgt gggcgacgtc gtggcgcgac gtcatcaagt tcaacagcat gggcttgggt       540
     atggaatccg aagggcagga actgatctcc accatcgaaa aggagatcgc cgacgaggtt       600
     gcctcgcatc cgcagcttgc cggcaaagca acaatgttcc tgacgcacgt cgacactgcc       660
     gacctgagtc aggtcagctt ctacactgcg aacgacacac gtgccgcgtt cttcgaggac       720
     cttggacttt cgacgccgaa gagcgttgcc gacgcctcga cgggtggtga gttctcgaag       780
     aaggtcagtg ccgagcgtgt ggacgtcttc gacgacgtcg aactgatcgt cacctacggt       840
     gaccaggcac ttgtcgacgc actcaaggct gacccgctgc tctcgcagat gcctgccgtc       900
     gccaacaatt cgatcgtgtt cctcaacgga accgggccga tgggaacggc ggccaacccg       960
     actccgctcg ccatttcgtg ggtactcggc gactatgtcg atctgctcgc cggggctgct      1020
     ggaaagtcgg agtga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page