(data stored in ACNUC1104 zone)

EMBL: AP008957.PE317

AP008957.PE317       Location/Qualifiers
FT   CDS_pept        358935..359978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03170"
FT                   /product="putative iron-siderophore ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31025"
FT                   /db_xref="GOA:C0ZM48"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM48"
FT                   /protein_id="BAH31025.1"
FT                   /translation="MTVTSQDSTSGASDTRRPTFGNSLWLIALLVVLAVLMCASIVIGS
FT                   REVDWSDIVAALGGSTDNIGQGAIAKRIPRTVLAIVVGAALGLAGAVMQGITRNPLADT
FT                   GILGVNMGASLAVVIGMAWFGLWTQTSMIWVAVLGAAGAALFVYVVGSLGRGGATPLKL
FT                   ALAGAATSAAFASFITAIMLPRNDIAGNIRSWQIGGVGGASFEVIRQGLPFLIVGFVIC
FT                   LLSARSLNSLALGDEVASGLGERVAVVRAVAALGAVLLCGAATAIAGPIGFVGLVVPHL
FT                   CRLLIGIDNRWLLPFSALTGAGLLVAADILGRIVARPSEIDVGIITALVGAPFFIYIVR
FT                   RQKIREL"
     gtgactgtaa cctcgcagga ttcgacgtcg ggcgccagcg atacgcggcg cccgacgttc        60
     ggcaattcgc tgtggctgat cgcccttctc gtggtcctcg cggtgctcat gtgcgcctcg       120
     atcgtcatcg gctctcgtga ggtcgattgg tccgacatcg ttgccgcact tggcggttcc       180
     accgacaata tcggtcaggg tgcgattgcc aagcgcattc cgcggacggt gctcgcgatc       240
     gtcgtgggtg ctgcgctcgg tcttgccggc gcggtgatgc aggggattac ccgaaaccct       300
     ttggcggata ccggaatcct gggcgtcaac atgggcgctt cgctcgccgt ggtgatcgga       360
     atggcgtggt tcggattgtg gacccagacc agcatgatct gggtggccgt actcggtgca       420
     gccggggcgg cattgttcgt ctacgtagtc gggtcactcg ggcgaggtgg agccacgcca       480
     ctcaagttgg ctcttgccgg ggccgcaaca tcggctgcgt ttgcttcgtt catcactgcg       540
     atcatgctgc cgcgaaacga tattgcgggc aacattcgtt cgtggcagat cggcggcgtc       600
     ggtggcgcga gtttcgaggt gatccggcag ggtctgcctt tcctcattgt cggcttcgtg       660
     atctgtctgc tgtcagcgcg cagtctcaac tctcttgcgc tcggcgacga ggttgcgtca       720
     ggtctcggcg aacgcgtcgc ggtggttcgt gcagtggcag cgctcggtgc agtgttgctc       780
     tgcggtgcgg ccactgccat tgccggaccg atcggcttcg tcggtttggt tgtcccgcat       840
     ctgtgccggt tgctgatcgg gatcgacaac cgttggctac taccgttttc tgcgctgaca       900
     ggtgccggcc ttctcgtcgc cgccgacatt ctcggacgaa ttgtcgcccg gccgagcgaa       960
     atcgacgtcg gcatcatcac cgcgctcgtc ggagcgccct tcttcattta catagtccgc      1020
     cgtcagaaaa tacgtgagct gtga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page