(data stored in ACNUC1104 zone)

EMBL: AP008957.PE318

AP008957.PE318       Location/Qualifiers
FT   CDS_pept        359975..361027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03180"
FT                   /product="putative iron-siderophore ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31026"
FT                   /db_xref="GOA:C0ZM49"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM49"
FT                   /protein_id="BAH31026.1"
FT                   /translation="MTTTFVTPEVEVDAVGASRIRRGRRRRIVIAVLTVLAVASFAVTL
FT                   MVGKTFYPPSDVLRVVLGENVPGASFTVGRLRLPRAVLAVVAGICFGLGGITFQTMLRN
FT                   PLASPDIIGISSGASAAAAFAIISLSLGGSQVSIFAIAVGLGVAVLIYVLSFRDGVAGT
FT                   RLILIGIGIAAMLDSVTAYLLSTAAAWDLQETMRWLTGSLNGANWGSTVPVVLALVVLG
FT                   PVLLSQSRNLSTIQLGDDAAQALGVRVERTRILSIIAAVGLIAFATAAAGPIAFVAFLS
FT                   GPIAARIVGPGTSLLIPSALVGALLVLVADFCGQYAFGTRYPVGVVTGALGAPYLVYLI
FT                   IRSNRTGGSL"
     gtgaccacta cattcgttac tcccgaagtc gaggtcgacg cagtcggagc aagccgtatc        60
     cgacgaggta gacgccgccg catcgtgatt gccgtgctga cggtcctcgc cgtcgcctcc       120
     ttcgcggtca ctctgatggt gggaaaaacc ttctacccgc cgtcagatgt gcttcgggtc       180
     gtgctggggg agaacgtgcc tggtgcctcg ttcaccgtcg gccgcctccg gttgcctcgc       240
     gctgtcctcg ctgtggtcgc cggaatctgt ttcggcttgg gcggcatcac gttccagacg       300
     atgctgcgca acccgctcgc gagccccgac atcatcggga tcagctcggg cgcaagcgct       360
     gcagcggctt tcgcgatcat ctcgctttcg ctcggcggct cgcaggtctc gatcttcgcc       420
     atcgctgtcg gtctgggcgt cgcagtcttg atctacgttc tgtccttccg agacggtgta       480
     gcgggcactc ggctgatcct gatcggtatc ggcatcgccg cgatgctcga cagcgtcacc       540
     gcctacctgc tcagtaccgc cgccgcgtgg gatctgcagg agacgatgcg ttggctcacc       600
     ggcagtctca acggtgccaa ctggggttcg acggttcccg tggtcctggc gctggttgtc       660
     ctcggaccgg tgctgctgag ccaatcgcgc aacctttcga ccatccagct cggtgacgac       720
     gcagcacaag cgctcggcgt cagagtggaa cgaacgcgca ttctgtcgat cattgcggcc       780
     gtcggactca tcgcctttgc cactgccgct gcggggccca tcgccttcgt cgcatttctg       840
     tcagggccca tcgccgcccg catcgtcggt ccgggaacat cacttttgat tccgtcggcg       900
     ctggtcggag cgctgctggt gctcgttgcc gatttctgcg gacagtacgc cttcggcacc       960
     cgctaccccg ttggcgtggt gaccggcgcg ctgggagcgc cgtatctcgt ctacctcatc      1020
     attcgctcca accgaacggg aggttcgctg tga                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page