(data stored in ACNUC1104 zone)

EMBL: AP008957.PE321

AP008957.PE321       Location/Qualifiers
FT   CDS_pept        362500..363678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03210"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31029"
FT                   /db_xref="GOA:C0ZM52"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM52"
FT                   /protein_id="BAH31029.1"
FT                   /translation="MPSIASSLFWIALIAAIAPIVAGLIPRRLVPEVVLLLVAGAVVGP
FT                   FALNIAADSEAIGILRELGLGMLFLLAGYEIDRQELSGRGGRRALYTWLFCLALAFTVV
FT                   ALLGMRNVISAEAAVAIAMTSTALGTLLPILKDNKLLDTRLGKTVLNHGAVGELGPVVA
FT                   MAVLLSARGAVLSLIVLAVFALIAIVVAVLPGKLIHEGSWTHRLVRAGADTTAQTTVRL
FT                   TVLLLVSLGVLSAVFSLDVILGAFAAGFILRRLMPEGDERLEIKLDGIAFGFLIPIFFI
FT                   TSGMAIDVSAVAASPGILIAFLILIVVVRGVPVFFVTKFEKVEPPFTTRESAQVALYGA
FT                   TGLPMIVAVTGAAVDAHQMSSDNASILVAAGAITVLLLPMLATLLTKKEKVS"
     gtgccttcaa ttgcctcgtc gctgttctgg attgcgctga tcgcggccat cgcgccgata        60
     gtcgcgggct tgatcccgcg tcgactggtt cccgaagtgg tgttgctact ggtcgcgggc       120
     gccgtggtcg ggccgttcgc cctcaacatc gccgctgaca gcgaagcgat cggaatcctc       180
     cgcgaactcg gcctcggcat gctgttcctg ctcgccggct acgagatcga tcgacaggaa       240
     ctcagtgggc gcggcggacg tcgagcgctc tacacgtggc tgttctgcct cgcgttggcg       300
     ttcacggtgg tcgcgctgct tggcatgagg aacgtgatct ccgcggaagc cgctgttgcc       360
     atcgcaatga cgtcgaccgc actgggcacg ctgttgccga tcctcaagga caacaaactc       420
     ctcgacacac gcttgggcaa gacggtcctc aatcacgggg ccgtcggcga actcgggccg       480
     gtcgtcgcga tggcggtgct gctgagtgcc cgtggtgccg tcctgtcgct gatcgttctt       540
     gccgtcttcg ccttgatcgc catcgtcgtg gcggtgctgc ccggcaagct gattcacgaa       600
     ggctcgtgga cacatcggct ggtgcgggca ggagcggaca ccacggcgca gacgacggtc       660
     cgcctcaccg ttctgttgtt ggtcagcctc ggagtgctgt cggccgtgtt ctcactcgac       720
     gtcattctcg gcgcgtttgc cgccggcttc atcctgcggc gactgatgcc agagggcgac       780
     gagcgcctcg agatcaagct cgacgggatc gccttcgggt tcctcatccc gattttcttc       840
     atcacttcag gcatggcaat cgacgtctcg gcggtcgccg ccagtcccgg catactgatt       900
     gcgtttttga tcctgatcgt tgtcgtccgc ggcgtgccgg tgttcttcgt gaccaagttc       960
     gagaaggtcg agccgccctt caccacgcgc gaaagtgcgc aagtcgcgtt gtacggggct      1020
     accggtctgc ccatgatcgt ggcggtcact ggcgctgccg tcgacgcgca tcagatgtcg      1080
     tcggacaacg cgtcgattct tgtcgcggcc ggtgcgatca ccgttctact gctgccgatg      1140
     ctcgccactc tcttgacgaa aaaggagaaa gtgtcctga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page