(data stored in ACNUC1104 zone)

EMBL: AP008957.PE322

AP008957.PE322       Location/Qualifiers
FT   CDS_pept        complement(363680..364924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31030"
FT                   /db_xref="GOA:C0ZM53"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM53"
FT                   /protein_id="BAH31030.1"
FT                   /translation="MPMSLASSFFAHPHQAFTAGFYRNESFDFELRVVLGQATYGAADT
FT                   GEVLSAIAHVGEKDLEGWYEAWFDLGTRVFGHADEAAEAGHSRSASNAYLRAASYFGVA
FT                   INAVDGLSDDSVLVPTFKRHRQAWDRFVDTTAQPVERVRIPYEDTYLPGYFFRPPGDVR
FT                   RPTLIMVNGSDGPISGLWGSGGAGALERGYNVLMFDGPGQQSMLFERNIPFRHDWESVI
FT                   TPVVDYLVDRPDVDASKLAIYGISQGGYWVPQSLAFEHRIAAAIADPGVVDVAASWLAH
FT                   IPKNMQKLLDEGKSEAFDRDMAMGMKFSKDTARIWRFRARPYLADGYYNTLAEVRKYHL
FT                   EHVAGSISTPLLITDPEGEQFWPGQSKRLAALSGGPTTVVPFTAAEGANFHCQPMARRL
FT                   TDQRMFDWLDEQLDL"
     gtgcccatgt ctctcgcgtc gtcgttcttc gcccatccac accaggcgtt cactgccggt        60
     ttctaccgca acgagtcctt cgacttcgag ctacgagtcg ttctcgggca agccacctac       120
     ggcgcggcag ataccggcga agtgctctcg gccatcgctc atgtcggcga gaaagacctc       180
     gagggctggt acgaggcctg gttcgacctc ggcacacgag tattcgggca cgccgatgag       240
     gcggccgagg ccgggcattc acgaagcgcg tccaacgcgt acctgcgggc ggcgtcgtac       300
     ttcggtgtgg cgatcaacgc cgtagacggt ctcagcgacg attcggttct ggtccccact       360
     ttcaaacgtc accgacaagc gtgggaccgc ttcgtcgaca ccaccgccca gcccgtcgaa       420
     cgcgtccgga tcccttacga ggacacctac ttgcccgggt acttcttccg gccgcccggc       480
     gacgtgcgac ggccgacgtt gatcatggtg aacggtagcg acggcccgat cagcggactg       540
     tggggcagcg gcggcgccgg ggccctcgaa cggggctaca acgtgttgat gttcgacgga       600
     cccggtcagc agtcgatgct cttcgagcgc aacatcccgt tccgtcacga ctgggaatcc       660
     gtcatcacgc ccgtcgtcga ctatctcgtg gaccggccgg acgtcgatgc gtcgaagctg       720
     gcgatctacg ggatcagtca gggcggttac tgggtaccgc agtcgttggc gttcgagcat       780
     cggatcgcgg cagcgatcgc cgatccgggg gtcgtggacg tggccgcgtc gtggctcgcc       840
     catatcccca agaacatgca gaagctgctc gacgagggga agtcggaggc cttcgaccgc       900
     gacatggcga tggggatgaa gttctccaag gacaccgccc ggatctggcg tttccgagcg       960
     cgtccgtacc tcgccgacgg ttactacaac actctcgccg aggttcggaa gtaccacctc      1020
     gaacacgtcg ccggctcgat ctccactccc ctgctcatca ccgatccgga aggcgagcag      1080
     ttttggcccg gtcaatccaa gcggcttgcc gccctatccg gcggaccgac gacggtggtt      1140
     cccttcaccg cggccgaggg cgcgaacttc cactgtcagc ccatggcgag gcgtctgacg      1200
     gatcagcgaa tgttcgactg gctcgatgag cagttggatc tctga                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page