(data stored in ACNUC1104 zone)

EMBL: AP008957.PE323

AP008957.PE323       Location/Qualifiers
FT   CDS_pept        complement(364998..365687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03230"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31031"
FT                   /db_xref="GOA:C0ZM54"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM54"
FT                   /protein_id="BAH31031.1"
FT                   /translation="MKERNAARWGLVAALALGGIVYSSWILEFFLDTGLDPVTSFLSEL
FT                   DAENQKYRDVFGNADVLSAILMLISGALGLLITPRRRLYVTGWIALAVFGIATIADASF
FT                   PLECSGEGCPSSAPDGLLPQLHHVHALTSSVAVFAIFTAMIAFTVGAFRYREHRSLRTT
FT                   GLTILILTSLATVWMLTTNSIEVSGGGNLGLGIAQRAQVLGMSLWLCTLAFAMSRPPST
FT                   GLPASPR"
     gtgaaggaac gcaacgctgc gcggtggggt ttggtggctg cgctggctct gggcggaatc        60
     gtctactcgt cgtggattct cgaatttttc ctcgacaccg gcctcgaccc ggtgacatcg       120
     ttcctcagcg aactcgatgc cgagaaccag aaataccgtg acgtcttcgg caatgccgac       180
     gtcctgtccg cgatcttgat gttgatctcc ggagcgctgg gtctgctgat cacgcccagg       240
     cgcaggctct acgtcacggg ctggattgca cttgcagtgt tcggcatcgc cacaatcgcc       300
     gacgcgtcgt tccctctcga atgctcgggc gagggctgcc cgtcgagcgc acccgacggt       360
     ctacttccgc agctccacca tgttcacgca ttgacgagca gcgtggcggt gttcgcgatc       420
     ttcaccgcga tgatcgcatt caccgtggga gcgttcaggt atcgcgaaca ccggtcgttg       480
     cgtacgaccg gcctgaccat tttgatcctg acttcccttg cgacggtgtg gatgttgacg       540
     accaacagca tcgaagtctc cggcggcggt aatctcggac tgggtatcgc tcaacgcgca       600
     caggtgctgg ggatgtcgtt gtggttgtgc accctggcat ttgcgatgtc gaggccgcca       660
     tccaccgggc tcccggcgtc gccacgctga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page