(data stored in ACNUC1104 zone)

EMBL: AP008957.PE325

AP008957.PE325       Location/Qualifiers
FT   CDS_pept        complement(366113..366988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31033"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM56"
FT                   /protein_id="BAH31033.1"
FT                   /translation="MTESLFPEPETLFPEPLFSEPEHEPLWSALQLAGDKPPADADRGE
FT                   KKNYAQRLSNQLAQTVADALRPLYPNITPTASGEGQEATVDVAKGRKRLDVKALDPTLG
FT                   LILCVSIKTYNFQDYSPRSGKLGRWTKNIVRNDHELRGEAMVLHQRQPYSVLVAVMFEP
FT                   YATCDDGDPTKTSDTGKSSFAHHVTTLSKRSGRGKRAVVGVPGKAWVDLGAEDTRYDLF
FT                   EKVYIGLYEPDGAVRFFDVDEPPPRNGRPTEAQTLSFTDFVTVVHGEVERRNRFAPTWS
FT                   DPEDSDDSDG"
     atgacggaat cactgttccc cgaacctgaa acgctattcc ccgaaccgct gttttccgag        60
     ccggaacacg aaccactgtg gagcgcactg caactcgcgg gcgacaagcc tccggccgac       120
     gccgatcgcg gcgagaagaa gaactacgcc cagcgactct ccaatcaact ggcacagacg       180
     gtggccgacg ctctgcgtcc gctgtatccc aacatcaccc cgacagcgtc cggcgaaggc       240
     caggaggcaa ccgttgatgt cgccaagggc cgaaagcgct tggacgtcaa ggcactcgac       300
     cccactctcg gcctgatcct ctgcgtctcc atcaagacgt acaacttcca ggactacagt       360
     ccccgcagcg gaaaacttgg acggtggacc aagaacatcg tccgcaacga ccacgaattg       420
     cgtggcgagg caatggttct gcatcagcgt cagccgtaca gcgtgttggt cgccgtcatg       480
     ttcgagccgt acgccacgtg cgacgacggc gacccgacca agaccagcga caccggcaaa       540
     tcctcttttg cacaccacgt cacgacgctc tcgaagcgct cgggccgggg caagcgcgcg       600
     gtggtcggcg ttccaggaaa ggcctgggtg gatctcggcg ccgaggacac ccgctacgac       660
     ctcttcgaga aggtctacat cggactctac gaacccgacg gcgcggttcg gttcttcgac       720
     gtcgacgaac cgccgccgcg caacggccgg cccaccgaag ctcagacgct ctcgttcacc       780
     gacttcgtga ccgtcgtgca cggtgaagtg gagcgtcgca acaggtttgc gcccacctgg       840
     tccgatcccg aagacagcga cgattccgac ggctga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page