(data stored in ACNUC1104 zone)

EMBL: AP008957.PE326

AP008957.PE326       Location/Qualifiers
FT   CDS_pept        complement(366985..368163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03260"
FT                   /product="putative modification methylase"
FT                   /EC_number="2.1.1.37"
FT                   /note="protein synonym:cytosine-specific DNA
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31034"
FT                   /db_xref="GOA:C0ZM57"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM57"
FT                   /protein_id="BAH31034.1"
FT                   /translation="MRKGAVTSSRSMVGLFAGIGGLELGLSEHGWNTELLCEIDPGAQA
FT                   VLRSRFADVPLHGDVTKLRALPSDIELVAAGFPCQDLSQAGKTAGITGARSGLVDEVFR
FT                   LVKRKKGPRWLLIENVPFMLQLGKGAAMRHITDALEDLGYTWAYRVVDARAFGLPQRRQ
FT                   RVIMLASRTDDPREILFGQDAGERLGGDPADYPCGFYWTEGTRGLGWAVNAVPTLKGGS
FT                   SVGIPSQPAVRLPSGEIVTPGLVDAERLQGFDPDWTLPSVEVPGLRHSHRWKLVGNAVS
FT                   VRMASWVGGRLNDPIAYDAAGETPLEPGDAWPSAAWGRNRQAFRVHTSTWPVQYDYEDL
FT                   SGFLEDTRLLSARATAGFLKRARMGNLRFIPGFIEDVESHLERMGGYPEAAA"
     gtgaggaagg gtgctgtgac gtcgtcgcgg agcatggtgg gtttgtttgc cggtatcggc        60
     gggctcgagt tggggctctc ggaacatggg tggaacaccg aactgctgtg tgaaatcgat       120
     ccgggcgccc aggcagttct ccgttcgcga ttcgccgacg tgccgttgca cggcgacgtc       180
     accaaactgc gcgcgctgcc cagtgacatc gaattggtgg ccgccggttt cccctgccag       240
     gacctctctc aagccggcaa aacagcaggc atcaccggcg cacgctcggg actggtggac       300
     gaggtgttcc gtctggtcaa gcgcaagaaa ggcccgcgct ggctgttgat cgagaacgtt       360
     ccgttcatgc tgcaactcgg caagggcgct gccatgcggc acatcaccga cgctctcgaa       420
     gacctcggat acacctgggc ataccgggtg gtggacgccc gcgccttcgg actcccccag       480
     cgccgtcagc gcgtcatcat gcttgcctcg cgcacggacg atcctcgcga aatcctgttc       540
     ggccaggacg ccggcgagcg cctgggaggt gatcccgcgg actacccctg cggcttttac       600
     tggaccgaag gcacccgcgg actcggatgg gccgtcaatg ccgtgccgac gctcaagggc       660
     ggctcgtccg tcggcatccc cagccagccg gcggtccggt tgccgtccgg tgagatcgtc       720
     actcccggcc tcgtcgacgc cgaacgcctg cagggtttcg atcccgactg gacgcttccg       780
     tccgtcgagg ttcccggcct acgccacagc caccgatgga agctcgtcgg caatgccgtg       840
     agcgtgcgga tggcgtcgtg ggtcggtggc cggctgaacg atcccatcgc atacgacgcc       900
     gcgggcgaga cgccactcga accgggcgac gcgtggccga gtgcggcatg gggccgtaac       960
     cgccaagcct tccgcgtcca cacctcgacc tggccggtcc agtacgacta cgaggatctg      1020
     agtggcttcc tcgaggacac gcggttgctg tcggcgcggg ccacagccgg cttcctcaag      1080
     cgcgcacgca tgggcaatct tcggttcatc cccggtttca tcgaggacgt cgaaagccat      1140
     ctcgagcgga tgggcggata ccccgaggcc gcggcatga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page