(data stored in ACNUC1104 zone)

EMBL: AP008957.PE33

AP008957.PE33        Location/Qualifiers
FT   CDS_pept        complement(39770..40234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30741"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLH3"
FT                   /protein_id="BAH30741.1"
FT                   /translation="MQGLILQLTRAGFLLLLWLFVWAVLRTLRSDIYAGSGVRVPPRYT
FT                   RAGKVLPSLGKAKVPRYLVVTQGALAGTRITLGSQPVMIGRADDSTLVLTDDYASTRHA
FT                   RLSQRGADWYVEDLGSTNGTYLDRAKVTTAVRVPLGTPVRVGKTVIELRP"
     gtgcagggcc tgattctgca actcacacgg gcgggcttcc tgctcctact gtggctgttc        60
     gtctgggcag tcctccgcac tctccgctcc gacatctatg ccggctccgg ggtcagggtt       120
     ccgccgcggt acacccgcgc cggaaaggtc ctgccctcgc tgggcaaggc gaaggtgcct       180
     cggtacctgg tggtcacgca gggcgccctc gccggtaccc gcatcaccct gggctctcag       240
     ccggtgatga tcggtcgcgc cgatgattcg acgctcgttc tcaccgacga ttacgcgtcg       300
     acgcgccatg cgcggctctc gcagcgcggc gctgattggt acgtcgagga tctcggttcg       360
     accaacggca cctatctgga ccgcgccaag gtcacaactg cggtgcgcgt cccgctgggc       420
     accccggttc gcgtcggcaa gacggtaatc gagctacgcc cgtga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page