(data stored in ACNUC1104 zone)

EMBL: AP008957.PE332

AP008957.PE332       Location/Qualifiers
FT   CDS_pept        complement(371697..372029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31040"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM63"
FT                   /protein_id="BAH31040.1"
FT                   /translation="MGTPTAISNHLVKWFLHSGPQPGVPGPCASNHASIPMRTVCPKHE
FT                   SHRSGELAMADLTLLTDDELRERRIALSRSLTTAADLIPTPPPSFFEKLKQDIDAAAAE
FT                   WIARRS"
     gtgggcacac ccacagccat tagtaatcat ttggtaaagt ggtttttgca ttccggcccc        60
     cagcctggag tgcctgggcc gtgcgcatcg aatcatgcat cgatcccgat gcgcacggtc       120
     tgcccgaaac acgaatcaca ccgatcgggg gagctcgcaa tggcggacct gacgctcctg       180
     accgacgacg agttacgcga gcgtcggatc gccctcagtc gatccctcac taccgcagca       240
     gatttgatcc ccaccccacc accctcgttc ttcgagaagc tgaagcagga catcgatgcc       300
     gccgctgcag agtggatcgc tcgccgctcc tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page