(data stored in ACNUC1104 zone)

EMBL: AP008957.PE336

AP008957.PE336       Location/Qualifiers
FT   CDS_pept        complement(373577..374518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03360"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31044"
FT                   /db_xref="GOA:C0ZM67"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM67"
FT                   /protein_id="BAH31044.1"
FT                   /translation="MWETLLESWKSLLEPLHDPVTLAIPAFVIFLAIEWFAARALEDHP
FT                   DDADGRARPAEGGYRSVDARTSVLLGLVSIATSTFWKVLALIGYSAIWVYLAPWHLSPT
FT                   AWYTWVILLLGIDVLYYAYHRIAHRVRVIWATHQAHHSSEYFNFSTALRQKWNNSGEII
FT                   MWLPLPFLGIPPWMVFVGFSVSLVYQFFVHTERVGKLWRPIEFIFNTPSHHRVHHGSDA
FT                   EYLDRNYAGILIIWDRMFGTFAAETHRPTYGLTTPVGTYNIWKLQTREYAAIARDWKAS
FT                   KSWRQRAGYVFGPPGWAPKAEVTSAESTAPSH"
     gtgtgggaaa cccttctcga atcatggaag tcacttctcg aaccgctcca tgatccagtc        60
     acgctcgcaa tccccgcgtt tgtcatcttc ctggcaatcg aatggttcgc ggcccgcgct       120
     ctcgaggatc atcccgacga cgccgacgga cgcgcacgac ccgcggaagg cggctaccga       180
     agcgtcgacg ccagaaccag cgttctgctc ggactcgtgt cgatcgcaac gagcaccttc       240
     tggaaagtgc tggcgctgat cggctattcc gcaatctggg tgtacctcgc tccgtggcac       300
     ctctcgccga cggcctggta cacctgggtg atcctgctgc tcggaatcga cgtcctctat       360
     tacgcgtatc accgcatcgc gcaccgagtt cgggtcatct gggccacaca ccaggctcac       420
     cattcgagtg agtacttcaa cttcagcacc gcactgcggc agaagtggaa caacagcggt       480
     gagatcatca tgtggttgcc gttgccgttc ctcgggattc cgccgtggat ggtgttcgtc       540
     ggcttctccg tcagcctcgt ctaccagttc ttcgtccaca ccgaacgtgt cggaaaactt       600
     tggcggccca tcgaattcat cttcaacacg ccgtcacacc atcgcgtcca ccacggctcc       660
     gacgccgagt acctcgaccg caactacgcc ggaatcctca tcatctggga ccggatgttc       720
     gggaccttcg cagccgaaac ccaccggccc acctacggac tcacgacgcc ggtcggaacg       780
     tacaacatct ggaagctcca aacacgcgaa tacgctgcca tcgctcgcga ctggaaagcg       840
     tcgaagtcgt ggcgccagcg cgcaggctac gtgttcggcc cacccggctg ggcaccgaaa       900
     gccgaggtca cgtcagcaga atccacagcc ccgtcgcact ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page