(data stored in ACNUC1104 zone)

EMBL: AP008957.PE337

AP008957.PE337       Location/Qualifiers
FT   CDS_pept        374647..375102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03370"
FT                   /product="putative Rrf2 family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31045"
FT                   /db_xref="GOA:C0ZM68"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM68"
FT                   /protein_id="BAH31045.1"
FT                   /translation="MHITAKVDYAVRTLVELAAVGPDPAKAEFLAKSQVIPHKFLEAVL
FT                   SDLRRGGLVNSRRGPDGGYWLARSADEITIADVIRAVEGPLASIRGQRPEDVDYGGPAT
FT                   PLKEVWIAVRVNLRAVLENVTLTDVAGGELPEFIHELTADPEAWNRR"
     gtgcatatca ccgcgaaggt ggactacgcc gtgcggactc tggtcgagct cgcggcagtt        60
     ggtcctgacc cggccaaggc cgagtttctc gccaaatccc aggtcatacc ccacaagttc       120
     ctggaagcgg tgctctcgga cctgcggcgc ggcggcttgg tcaacagccg tcgaggcccg       180
     gacgggggat actggctcgc gcggtccgcg gacgagatca cgattgcaga cgtcatacga       240
     gccgtcgaag gaccgcttgc ttcgattcgg ggtcagcgac cggaagacgt cgactacggg       300
     gggccggcga cgcccctcaa ggaggtgtgg attgcagtgc gcgtcaacct ccgtgctgtg       360
     ctcgaaaatg tcacactcac cgatgtagca ggtggagagt tgcccgagtt cattcacgaa       420
     ctgacggcag atcccgaggc gtggaatcgg cgctga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page