(data stored in ACNUC1104 zone)

EMBL: AP008957.PE338

AP008957.PE338       Location/Qualifiers
FT   CDS_pept        complement(375115..376224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03380"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31046"
FT                   /db_xref="GOA:C0ZM69"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM69"
FT                   /protein_id="BAH31046.1"
FT                   /translation="MDPLLHTWPVSSTVMLWGSKSGRGSVLRLVRLTIGFCSLNFSIVA
FT                   FLFLLSGEGPDGPFARSWLVGIATVNLIPTILWFVGRIRGSRMLKLYGLWADLGTASIL
FT                   ITFTSHNAALFGAALFVATGAYFTYFLDRRWLAFHLAFATTFVIALTVLGLTNGDYSAT
FT                   SVIARTDVVLCAVIFIPATIQFTWRQLLSRATGSKVDALTGLLNRRGLWDMSERIWSVA
FT                   SANRADIAVAVVDIDKFKAVNDTFGHEVGDAVIIRTGTRLQEHVNGFGYAARTGGEEFT
FT                   VVMIGTPYGLRKRIATLPKAVVNASDDPLATVSVGAATLPFIPHQEEFDYNEFSRAIVA
FT                   ADHLMYDAKSAGGNAANTAPMTVPRRRAP"
     atggacccgc tcctgcatac ctggccggtt tcgtccacgg taatgctgtg ggggtcgaag        60
     tccggacgag gctccgtact acgtctcgtc cgtctcacca tcggattctg ctcactcaat       120
     ttctcgatcg tggcgttcct gtttctcctc agcggagagg gcccggacgg accgtttgcg       180
     cgcagttggc tcgtcggcat tgcgaccgtc aacctgatcc ccacgattct ctggtttgtc       240
     ggccgaatca gaggttcacg catgctcaag ctctacggtc tgtgggcgga tctcggaact       300
     gcctcgattc tcatcacctt caccagccat aacgccgccc ttttcggcgc ggcactcttt       360
     gtcgccaccg gcgcctactt cacctatttt ctcgaccgcc gctggctggc attccacctc       420
     gcctttgcca cgacgtttgt catcgccctg accgtgctcg gcctgacgaa cggcgactac       480
     tcggcaacca gcgtgattgc acgcaccgac gtcgtactgt gtgccgtgat cttcattccg       540
     gccaccattc aattcacctg gcggcaatta ctctcgcgcg caacgggatc caaggtggat       600
     gcactcaccg gactgctgaa ccggcgaggg ctgtgggaca tgtcggagcg catctggtcg       660
     gtcgcgtcgg caaatcgtgc cgacattgct gttgccgtcg tcgacatcga caagttcaag       720
     gctgtgaacg acaccttcgg tcacgaagtc ggtgacgccg tcatcatccg gaccggaaca       780
     cgcctgcagg agcatgtgaa cggtttcggc tacgccgcgc gcaccggcgg cgaggagttc       840
     accgttgtga tgatcggcac cccgtacgga cttcgcaaaa gaatcgcgac actgcccaaa       900
     gccgtcgtga acgcttccga cgaccccttg gccacggtca gcgtcggagc agcgacgcta       960
     cctttcatcc cgcatcagga agagttcgac tacaacgagt tctcccgggc aatcgttgcg      1020
     gccgatcatc tgatgtacga cgcaaaatcc gcgggaggca acgctgcgaa cactgctcct      1080
     atgactgttc cgcgtcgacg ggcaccctga                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page