(data stored in ACNUC1104 zone)

EMBL: AP008957.PE341

AP008957.PE341       Location/Qualifiers
FT   CDS_pept        379646..381379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03410"
FT                   /product="putative ABC transporter permease/ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31049"
FT                   /db_xref="GOA:C0ZM72"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM72"
FT                   /protein_id="BAH31049.1"
FT                   /translation="MLIRLLRTYLTPYRGELTGVVVLQFISTMAALYLPSLNADIIDNG
FT                   VTKGDTGYILSTGGMMLMVTLTQILCSVGAVFFGARVAMGVGRDLRASVLHQVGTFSAR
FT                   EVGHFGAPSLITRNTNDVQQVQMMVVMSCTILVMAPIMCIGGIIMALRQDLNLSWILGI
FT                   SVPLLVVSMGFLIARMVPGFRVMQGRLDAVNRVLREQITGIRVVRAFVREPYEVERFGD
FT                   ANRELTETALGVGRLMALMFPLVMLISNVTSVAVIWFGGHQINEGSMQIGSLTAMLSYI
FT                   MQILMAVMMATFMAVMLPRASVCAERISEVLDTDSSVIPPENPVLELKDPGVVELRGAQ
FT                   FQFPGAEEPVLRDITFRAEPGKTTAIIGGTGSGKTTLLNLIPRLIDSTSGSVSVGGVDV
FT                   RDIDTELLCSVIGLVPQKPYLFSGTVATNLRYGNPEATDEWLWECLEIAQAADFVRAMP
FT                   EGLDTPVAQGGTTVSGGQRQRLAIARALVRKPQIYLFDDSFSALDLTTDARLRAALRPV
FT                   TQNACIVVVAQRISTIVEADQIIVLDDGAIVGIGTHDELVVSCPTYGEIVASQLAVQDA
FT                   S"
     atgctgatca ggctgctgcg cacttatctg acgccgtacc ggggtgaact cacgggcgtt        60
     gtcgtcctgc agtttatttc gactatggcg gccctttacc ttccgagtct caacgccgac       120
     atcatcgaca acggcgtgac caaaggcgac accggctaca tcctctccac cggcgggatg       180
     atgctgatgg tcacgctgac gcagatcctg tgctcggtgg gtgccgtctt cttcggagcg       240
     cgagtcgcca tgggtgtcgg gcgcgatctc cgagcgtcgg tgttgcatca ggtcgggacg       300
     ttctcggcca gggaggtcgg gcacttcggt gcgccttcgc tgatcacccg caacaccaac       360
     gacgtccagc aagtgcagat gatggtcgtg atgagttgca ccatcctcgt catggcgccg       420
     atcatgtgta tcggcggcat catcatggct ctgcgccagg acctgaatct ttcctggatc       480
     ctcgggatca gcgtcccgct cctcgtagtc tcgatgggtt tcctgattgc ccggatggtc       540
     cccggattcc gggtcatgca gggccgcctc gacgccgtca accgtgttct tcgcgaacag       600
     atcacgggca tccgcgtcgt ccgagcgttt gtacgggaac cgtacgaggt agagcgtttc       660
     ggcgacgcca accgcgaact gacggagact gcactcggcg tcggccgcct catggcactg       720
     atgttcccgc tcgtgatgct gatcagcaat gtcaccagcg tcgcggtcat ctggttcggt       780
     ggccatcaga tcaacgaggg ctcgatgcag atcggctcgc tcaccgcgat gctcagctac       840
     atcatgcaga tcctgatggc cgtcatgatg gccaccttca tggcggtgat gctgccgcgt       900
     gcgtcggtgt gcgccgaacg tatctccgag gtactcgaca ccgattcctc ggtgattccg       960
     cccgagaatc cggtcctgga gttgaaggac ccgggcgtcg tcgaacttcg tggggctcag      1020
     ttccagttcc ccggagccga ggagccagtg ttgcgcgaca tcaccttccg cgccgaacca      1080
     ggcaagacga cggcgatcat cggcggcacc ggatcgggaa agaccacgct gctcaacctg      1140
     attccgcgtt tgatcgactc cacctccgga tcggtatcgg tgggcggtgt cgacgtccgc      1200
     gacatcgaca cggagctgct ctgctcggtg atcggtctgg tcccgcagaa gccgtatctg      1260
     ttctccggca ctgtcgccac caatctccgc tacggaaacc ccgaagctac cgacgaatgg      1320
     ctgtgggagt gcctcgagat cgcccaagct gccgacttcg tccgcgccat gccagaaggc      1380
     ctggacacac cggtggcaca aggcggtacg acggtatcgg gcggtcagcg tcagagactc      1440
     gccatcgcga gagcgttggt gcgtaagccg cagatctatc tgttcgacga ttccttctcg      1500
     gcgctcgacc tcactaccga cgcacggctg cgtgcggcgc tccggccggt cacgcagaac      1560
     gcctgcatag tcgttgtcgc gcagcgtatc tccactatcg tcgaggccga tcagatcatc      1620
     gtgctcgacg acggcgccat cgtggggatc ggcacgcacg acgaactcgt ggtcagttgt      1680
     cccacctacg gcgaaatcgt cgcctctcag ctagccgtac aggacgcatc atga            1734
//

If you have problems or comments...

PBIL Back to PBIL home page