(data stored in ACNUC1104 zone)

EMBL: AP008957.PE342

AP008957.PE342       Location/Qualifiers
FT   CDS_pept        381376..383307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03420"
FT                   /product="putative ABC transporter permease/ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31050"
FT                   /db_xref="GOA:C0ZM73"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM73"
FT                   /protein_id="BAH31050.1"
FT                   /translation="MSNRPTSSPPIGPPGGGDPTKKAMNFGPSLKRLLGRLSPDKPIVI
FT                   LIFALVTASVVLSSIAPKILGNATNLIFDGIVSKQLQPGTTKEQAVEGLRASGQGQLAD
FT                   MVSGMAVVPGTGIDFDAVGKVLMIVLLLFVCASLFSWLQAYLLNIVVQRTVRRLREDVE
FT                   QKIHRLPLRYFDTHARGDVLSRVTNDIDNVAQSLQQTLSQLVMSVMTVLGILVMMLWIS
FT                   PLLALIAVATVPLSIMVTAFIAKRSQKHFVAQWKSTGGINAQVEEAFSGHELVKVFGRQ
FT                   QEVEERFRKQNEDLYESSFKAQFISGLVMPAVMFLGNLNYVAIAVVGGMRVASGTMTLG
FT                   DVQAFIQYSRQFTQPLTQIASMTNLLQSGVASAERVFALLDQDEQSEDPKGAKSPTVDK
FT                   GRVKFENVTFSYKPEQPLIEDLSLTAEPGQMVAIVGPTGAGKTTLVNLILRFYELNSGR
FT                   ITLDGIDIADMTRDDLRSRIGMVLQDAWLFGGTIRENIAYGKPGATDEEIRRAAEMSYV
FT                   DKFVHSLPEGYDTVIDEEGSNVSAGEKQLITIARAFISQPSILILDEATSSVDTRTELL
FT                   VQSATAVLRSDRTSFVIAHRLSTIRDANLIVVMEEGRIVEQGSHEALLESRGAYFRLYN
FT                   SQFVGAEI"
     atgagtaatc gaccgacttc ctcgcctccc atcggcccgc ccggcggcgg cgatcccacc        60
     aagaaggcca tgaacttcgg cccttcgctc aagcgtctcc tcggtcgctt gagcccggac       120
     aagccgatcg tcatcctgat cttcgctttg gtgacggcaa gcgtcgtact ttcctcgatc       180
     gcgccgaaga tcctgggaaa cgccaccaat ctgatcttcg acggcatcgt cagtaagcaa       240
     ctccagccgg ggacgacaaa ggaacaggct gtcgaaggat tgcgcgcttc ggggcagggt       300
     caactcgccg acatggtgtc cggcatggcc gttgtgcccg gaaccggaat cgatttcgac       360
     gccgtcggca aggtcttgat gatcgtgctg ctgctgttcg tctgcgcgtc gctgttcagt       420
     tggctgcagg cgtatctgct caacatcgtt gtgcaacgga ccgttcgtcg gctgcgtgag       480
     gacgtcgaac agaagattca tcgacttccc ttgcggtact tcgataccca tgcccgcggt       540
     gacgtactct cgcgcgtgac caatgacatc gacaatgtcg cgcagagctt gcagcagacg       600
     ctcagccagt tggtcatgtc ggtgatgacc gtcctgggca ttctggtgat gatgctgtgg       660
     atctcaccgt tgctcgccct gattgcagtg gcaactgttc cgctgtcgat catggtcacg       720
     gcgttcatcg cgaaacgttc gcagaagcac ttcgtcgcgc agtggaagag caccggcgga       780
     atcaatgcac aggtcgagga agcattcagc ggtcacgagt tggtcaaggt gttcggccgc       840
     cagcaggagg tcgaggagcg cttccgcaag cagaacgagg atctgtacga gtcgagtttc       900
     aaggcgcagt tcatctccgg tctggtcatg ccggccgtga tgttcctcgg caacctcaac       960
     tacgtcgcca tcgcagtggt gggtggcatg cgcgtcgcat ccggaacgat gacgctcggc      1020
     gacgtgcagg cgttcatcca gtactcgcgt cagttcaccc agccgctcac gcagatcgcg      1080
     tcgatgacaa atctgctgca gtccggtgtc gcttcggccg agcgtgtttt tgcgctgctc      1140
     gaccaagacg agcagtcgga ggacccgaag ggcgcgaagt cgcccacggt cgacaagggc      1200
     cgcgtcaagt tcgagaacgt caccttcagt tacaagccgg aacagccgct gatcgaggac      1260
     ctgtccctga ccgccgagcc cggccagatg gttgcgatcg tcggccccac cggggcaggc      1320
     aagaccaccc tcgtcaacct catcctgcgg ttctacgaac tcaattcggg ccgaatcact      1380
     ttggacggta tcgatatcgc cgacatgacg cgagacgatc tacgttcacg catcggcatg      1440
     gttctgcagg acgcgtggct gttcggtgga accatccgcg agaacatcgc ctacggcaag      1500
     cctggtgcca ccgacgagga gattcgtcgt gcggccgaga tgagctacgt cgacaagttc      1560
     gtgcactctc tgcctgaggg ttacgacacg gtcatcgacg aggaaggcag caacgtcagt      1620
     gcaggcgaga agcagctcat cactatcgcc cgcgccttca tctcgcagcc gtccatcctg      1680
     atcctcgacg aggcgaccag ttcggtggac acacgcaccg aactactggt tcagagcgcc      1740
     accgcggttc tgcgcagtga ccgcaccagt tttgtcatcg cgcaccgtct ttcgacaatt      1800
     cgtgatgcga acctgatcgt ggtgatggag gaaggccgca tcgtggagca ggggagccat      1860
     gaggctctgc tcgaatcccg cggcgcgtac ttccgtctgt acaacagcca attcgtgggc      1920
     gcggagatct aa                                                          1932
//

If you have problems or comments...

PBIL Back to PBIL home page