(data stored in ACNUC1104 zone)

EMBL: AP008957.PE343

AP008957.PE343       Location/Qualifiers
FT   CDS_pept        383330..383998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31051"
FT                   /db_xref="GOA:C0ZM74"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="InterPro:IPR038261"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM74"
FT                   /protein_id="BAH31051.1"
FT                   /translation="MLIAEDLLLLATDDVSGKLLRSSSYVDVALGGALLVELVLADRVR
FT                   LDGAGWRARAVVIDNRPLADPTLNAALARLAEKPPARPTAVVNRLAKGARKALYAGMGA
FT                   RGIVTAVEHQVLGFFPTVRWPATNPRYEDQLRFVLREILLGVRQPTPTEGALVSILAGA
FT                   NMLKVVVPADQFKAAKARAKVLSQGNWASEAVRQSIAATQAATTAALTATIAVSTSSGS
FT                   "
     atgctgattg ccgaggatct gctgttgctc gccaccgacg acgtcagcgg aaagctgctg        60
     cgttcgtcgt cctacgtcga tgttgcgctc ggaggcgcct tgttggtcga gcttgtgctt       120
     gccgaccgcg tccgcctcga cggcgccgga tggcgggcgc gggcagtcgt catcgacaat       180
     cggccactcg cggatcccac tctcaacgct gcattggcac ggctggccga gaaaccaccg       240
     gcccggccaa ctgcggtggt gaaccgactt gcgaagggcg caaggaaggc gctctatgcg       300
     ggtatgggag cccgcggaat tgtgacggcc gtggaacatc aagtgctcgg gttctttccg       360
     accgttagat ggccggcgac caatccgcgg tacgaggatc aactgcgctt cgtgcttcgt       420
     gagattctgc tgggggtccg ccaacccacc cccaccgaag gtgcattggt gtcgatcttg       480
     gcaggcgcga acatgcttaa ggtggtcgtt ccggccgatc agttcaaggc ggcgaaagcg       540
     cgagcgaaag tgctgtcgca aggaaactgg gcgagcgagg cagtgcggca gtcgatcgcg       600
     gcgacgcagg cagccaccac tgcggcgctc accgcaacaa ttgccgtgtc gacatcctcg       660
     ggatcgtga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page