(data stored in ACNUC1104 zone)

EMBL: AP008957.PE349

AP008957.PE349       Location/Qualifiers
FT   CDS_pept        complement(388675..389415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31057"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM80"
FT                   /protein_id="BAH31057.1"
FT                   /translation="MVRELREALDDHQFEVLYQPQVNLNSSAIISYEALLRWRHPLRGL
FT                   IEPQDFMRSAESSGLIIPIGLQALDMICAQTASWPEHMMVAVNFSPRQLATPHAAHEIL
FT                   GALDSSETPLSRIIVEVTELGVVGRHAAETLHVLHNEGIRIALDDFGAGFASFSALSEL
FT                   PLDILKIDQSLTWAVSAAGRAGDRAFMVMESIADIARKLGLDSIAEGVETAEHAANVLQ
FT                   AGCDMGQGYYFGKPLPASSIVTPV"
     atggtccgcg agcttcgcga ggcactcgac gaccatcaat tcgaggtgtt gtatcaaccc        60
     caggtcaatc tgaactcgtc agcaattatc agctatgaag cacttctgcg gtggcgccat       120
     ccgcttcgag ggttgatcga accccaagat ttcatgcgct ccgccgaatc ctctgggctc       180
     atcattccca tcgggctgca ggctctggac atgatctgtg cccaaacagc gtcgtggcct       240
     gagcacatga tggtcgcggt caacttttca cctcgccaac tcgctacccc gcacgccgct       300
     cacgagatcc tcggagcgct ggacagttca gaaaccccac tgagcagaat catcgtggaa       360
     gtcaccgaac tcggcgtcgt gggtcggcat gccgccgaga ctcttcacgt cttgcataac       420
     gagggaattc gaatcgcgct ggatgatttc ggggcgggct tcgcgtcttt ctccgcgttg       480
     tcggaattgc cgctcgacat tctcaagatc gaccaatcct tgacctgggc cgtcagcgca       540
     gcgggtcgtg ctggagaccg cgccttcatg gtcatggagt caatcgccga catcgctcgg       600
     aaactcgggc ttgattcgat cgccgagggc gtcgaaaccg cggaacacgc agccaacgtc       660
     ttgcaggccg gctgcgatat gggccagggc tattacttcg ggaagccgct tcctgcgtcg       720
     tccatagtca ctcccgtgtg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page