(data stored in ACNUC1104 zone)

EMBL: AP008957.PE35

AP008957.PE35        Location/Qualifiers
FT   CDS_pept        complement(42233..42643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30743"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLH5"
FT                   /protein_id="BAH30743.1"
FT                   /translation="MVAISWLLGIPRTDAVTTKGSTSVNGLETPTRLSRTTAALGVGAL
FT                   AAAITFGSAVGTASADTPVADFGSLSFSVTNGPDNTIYDINAIINLPPGTLPPGMMNPQ
FT                   ITAPAAATQPVNDSFAGTALDFVLSFIQAAAR"
     gtggttgcaa tctcctggct gcttggcatc ccgcgcacgg atgctgtcac cacgaaaggg        60
     agcacatctg tgaatggact cgaaacgcct actcgtttgt cccggaccac cgccgccctc       120
     ggtgtcggcg cactcgctgc cgcgatcacc ttcggcagtg cagttggtac tgcatcggcc       180
     gacactccgg tcgccgactt cggcagtctc tcgttctcgg tgaccaacgg tcccgacaac       240
     accatctacg acatcaacgc catcatcaat ctcccacccg gcacactgcc gccagggatg       300
     atgaaccccc agatcactgc gcccgccgcg gccactcaac ccgtcaacga ctcgtttgcg       360
     ggcaccgcac tggacttcgt tctgagcttc attcaggctg cggccagata g                411
//

If you have problems or comments...

PBIL Back to PBIL home page