(data stored in ACNUC1104 zone)

EMBL: AP008957.PE360

AP008957.PE360       Location/Qualifiers
FT   CDS_pept        398782..399135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31068"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM91"
FT                   /protein_id="BAH31068.1"
FT                   /translation="MIGAAAPRTDDQWTRMICSSWEAPEHVGGHVYATAAANDPVPMIG
FT                   DVFGGLSHGANPANDLPLIGFGATVIESAPGTGIDAGLLGELPSPVAHSEYWERTNPAL
FT                   AGMGHVIAGLGAP"
     gtgatcggcg ctgcggcgcc tcggacggac gatcaatgga cgcgaatgat ctgttcttcg        60
     tgggaagccc cggaacatgt cggtggccat gtatacgcca ccgccgcggc aaatgatccg       120
     gttccgatga tcggggacgt gttcggcggt ctctcgcatg gcgcgaaccc cgcgaacgat       180
     cttccgctga tcggattcgg tgccactgtc atcgaatccg cacccggaac cgggatcgac       240
     gcgggtctgt tgggcgagct ccccagccca gtcgcacaca gcgagtattg ggaacgcacc       300
     aacccggctc ttgccgggat gggccacgtg atcgccggac taggagcgcc atga             354
//

If you have problems or comments...

PBIL Back to PBIL home page