(data stored in ACNUC1104 zone)

EMBL: AP008957.PE361

AP008957.PE361       Location/Qualifiers
FT   CDS_pept        399132..399722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31069"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM92"
FT                   /protein_id="BAH31069.1"
FT                   /translation="MTNATRRRKALGMSSIAVAILLSACTTLLSACTTTENGKVMEANL
FT                   NLTLMQAQAKVIEYMTDTITVLPPGAYLTRYSELNQKVTLDPGGTVPCNDSNLSKDTSV
FT                   DYGVTYFLTSTETADIPGFGDPIRNLWTERGWKFRTYDSAGDSTSTETILPDGYRMVLE
FT                   EYARGASLTGSSPCFPRPDASDRPNAPVQIDQP"
     atgaccaacg caacgcgacg ccgtaaagca ctcggcatga gcagtatcgc ggtggcaatc        60
     ctgctgtcgg cgtgtacgac cctgctgtcg gcgtgtacga cgacggagaa cgggaaagtg       120
     atggaagcca acttgaatct gaccctcatg caggcacagg ccaaggtgat cgaatacatg       180
     acggacacga tcacggtact gccgccgggc gcctacttga cgcggtattc cgaactgaac       240
     cagaaggtca ccctcgatcc gggtggcacc gtcccgtgca atgacagcaa tctatcgaag       300
     gacacatccg tggactacgg cgtgacgtac ttcctcacct caactgaaac cgccgacatc       360
     ccaggtttcg gtgatccgat tcgcaatctg tggactgagc gcggctggaa gtttcgaacg       420
     tacgactccg ctggggactc gacgagcacc gagacaatct tgccggatgg atatcgaatg       480
     gttctggagg agtacgcgcg gggagcaagt ttgaccgggt cgtcgccgtg tttcccccga       540
     cccgatgcat cggatcgtcc gaacgcgccc gtgcagatcg atcaaccttg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page