(data stored in ACNUC1104 zone)

EMBL: AP008957.PE374

AP008957.PE374       Location/Qualifiers
FT   CDS_pept        413860..414231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31082"
FT                   /db_xref="GOA:C0ZN30"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN30"
FT                   /protein_id="BAH31082.1"
FT                   /translation="MTDVRASEAFPVTQAMKDSGGWNPLWDGLSELDPEWTELYMKTAM
FT                   QPWNSGVLSPQVIQLLCIAVDAASTHMYAPGVRRHIRAALDMGVTPKEILEVLKLTTVV
FT                   GIHSCNVGVPILMEEIANR"
     atgactgacg ttcgagcaag tgaagctttt cccgtgaccc aggctatgaa ggattcgggt        60
     ggctggaatc cgttgtggga cggactttcg gagctggatc ccgagtggac cgagctgtac       120
     atgaagacag caatgcagcc ctggaacagt ggggtgctgt cacctcaggt gatccagttg       180
     ctgtgcatag ccgtcgatgc ggcgagcacg cacatgtacg cgcccggcgt acgacgccat       240
     attcgcgccg cgctcgacat gggagtgacc ccgaaggaga ttctcgaggt gctgaaactg       300
     accaccgtcg tcgggattca ctcctgcaat gtcggcgttc cgatcctgat ggaggaaatc       360
     gcgaaccggt ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page