(data stored in ACNUC1104 zone)

EMBL: AP008957.PE382

AP008957.PE382       Location/Qualifiers
FT   CDS_pept        431988..433061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31090"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN38"
FT                   /protein_id="BAH31090.1"
FT                   /translation="MYLQARRMPSHTEIDALQTVVDAQHGLVTHTQLHTIGFPRSRVKQ
FT                   RVEVGRWQTVLRGVYSVTTGPLTRYAVLEAALLYGGGSSMLSHHTAAEEWSMRRPDGTA
FT                   PVHITVPYGKSAISQAATFVRGLGADRHPSPLIGTVLHPGVVVHRSRAHRHIGVDAQMP
FT                   RTGKADTALDLAVAEPTPREAYVSLITTVTNGRIRLTDIRRRMEERSPRRYRKALESAV
FT                   KLLADGVQSTLEYHYAVDVEQAHGLPSARRQSPVRVDGRTLYEDCDYSEVGVPLIVRLD
FT                   GRWAHSMAEVAFRDRRRDNAAELAGRPRLVYGFDEVMKTPCQVAHEVETVLRRGGWERR
FT                   GENPCGACEWLRSTETP"
     atgtatttgc aggctcgtcg tatgccttca catacagaaa tcgatgcatt gcagaccgtc        60
     gtcgatgctc agcacggact ggtcactcac actcaacttc acaccatcgg atttcctcgc       120
     tctcgcgtga aacaacgagt tgaggtcgga cgctggcaaa ctgttcttcg cggcgtctac       180
     tccgtcacca cgggcccatt gaccaggtat gccgtactcg aggccgcgct cttgtacggt       240
     ggcgggtcgt cgatgctcag ccatcacacc gccgctgagg aatggtcgat gcgtcggccg       300
     gatggcactg cacccgtaca tatcaccgtt ccgtacggga agtctgcgat ctctcaggcc       360
     gccacgttcg ttcgtggcct cggcgccgac cgacatccat cacccctgat cggcactgtc       420
     ctccatcccg gcgttgtggt ccaccgttcg agggctcatc gtcacatcgg cgtcgacgcg       480
     cagatgccgc gcaccggcaa ggctgataca gcactcgatc tggccgtcgc agaaccgact       540
     ccgcgcgagg cctatgtcag cctcatcacc acagtcacca acggccgcat ccgcttgacg       600
     gacatccgcc gacgcatgga ggagcgctca ccccgtagat accggaaggc cctcgaaagt       660
     gcggtgaagc ttttggccga cggggtgcaa tcgactctcg aatatcacta tgcggtggat       720
     gtggagcagg cgcacgggtt gccgtcggcc agacgccagt caccggtccg cgtcgacggc       780
     cgcacgctgt acgaggattg cgattacagc gaggtgggtg tgccgctgat cgtgcgtctc       840
     gacggtcggt gggcgcattc catggcagaa gtggcatttc gtgatcgccg ccgtgacaat       900
     gcggcagaac tggcaggtcg tccgcggttg gtctacggat tcgacgaggt gatgaagact       960
     ccgtgccagg ttgcacatga agtggagacg gtcttgcggc gcggaggctg ggagagaaga      1020
     ggggagaacc cctgcggggc ctgtgagtgg ttaaggagta cagagactcc ttaa            1074
//

If you have problems or comments...

PBIL Back to PBIL home page