(data stored in ACNUC1104 zone)

EMBL: AP008957.PE385

AP008957.PE385       Location/Qualifiers
FT   CDS_pept        435931..436119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31093"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN41"
FT                   /protein_id="BAH31093.1"
FT                   /translation="MIELLQSNSVNAPSGEPAHTEWVDGRDTRAQQAVWKGISAQFEVR
FT                   IRVVIRGIEPRWSSKET"
     ttgatcgagt tgttgcaatc gaactcggta aatgctccga gtggtgaacc agctcacacg        60
     gaatgggtag atggtcgaga tacccgggcg cagcaggcag tatggaaagg aatatctgcg       120
     cagttcgagg tgcggattcg ggtagtcatt cgcggtatcg agccgcgttg gtcgagcaag       180
     gagacgtag                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page