(data stored in ACNUC1104 zone)

EMBL: AP008957.PE387

AP008957.PE387       Location/Qualifiers
FT   CDS_pept        complement(436614..438125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31095"
FT                   /db_xref="InterPro:IPR010427"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN43"
FT                   /protein_id="BAH31095.1"
FT                   /translation="MQPTVSQLRTWSPEKLRTSTSELIGIDRQIEALGNDAGRSIDAVR
FT                   EFWQGQASSAAAVQWSGISLSSSRLSIAVRVVADLYGGAANTIGAARKSVLDLVEEATL
FT                   EHGLTVSDSGAVSAPETKQPWNLADVMQESENATAAEIFQQRISTALTALDDEDNRAAT
FT                   ALSEAFREIGSLLGNQTDRLNRTVVDIIDGRSTLPGTPTELHRLWESLTPNEKDALARW
FT                   DPSIGSRDGLPALDRDYYNRRYLTALEQLPDRTVAAGYTAVRGELRPDTFLLSVTDGHA
FT                   VVAVGNPDAADNVATLVPGTGSGLSGVGGDLQRTKAMYDAAVAAAPTEATSVILWSGYD
FT                   APPGIPDAASDRYANSAAPRLDSFQDGLRTSHDGQPSHNVVIGHSYGSTVVGAATTRGA
FT                   SLDVDELVFVASPGVDVERVNELSLDGVDSDEVARHVHSTTAFWDPVQLIPKILGVHGF
FT                   DPSDPEFGAQIFAGSPGQPGFGVHSDYWESRNPALTELGRIITGP"
     atgcagccca ccgtctctca gcttcgaacg tggtcaccgg agaaattgcg cacgagcact        60
     tcggaactga tcggcatcga ccggcagatc gaagctctcg gcaatgacgc cggacgcagc       120
     atcgacgccg tccgcgaatt ctggcaggga caagcgtcga gcgcggcggc agtgcagtgg       180
     tctggcatct cgctttcctc gtcgcggctg tcgattgcgg ttcgcgtagt tgcggatctg       240
     tatggcggag cggccaatac gatcggggcg gcacgaaaat cagttctgga cctggtcgag       300
     gaggcgactc tcgaacacgg cttgacggtg tcagacagtg gagctgtatc ggcgcctgag       360
     acgaagcagc cgtggaatct ggccgacgtc atgcaagaat ccgaaaacgc cacggctgca       420
     gagatttttc agcagaggat ctccactgca ttgacggcac tcgacgatga agacaaccgg       480
     gccgcgactg ctctgagtga ggcattccgg gagatcggat cactccttgg caatcagact       540
     gatcgcctca accgcactgt cgtcgacatc atcgatggga ggtcgacact ccccgggaca       600
     ccaacggagc tacaccgact gtgggaatcg ctcactccca acgagaaaga cgcgttggcg       660
     aggtgggatc cgtccatcgg tagccgcgac ggccttcccg ctctagaccg ggactactac       720
     aaccggcggt acctcacggc gctcgagcag ttgccggatc gaacggtagc tgccggatac       780
     acggccgtgc gcggcgaact gcgaccggac acgttccttc tctcggtcac ggatgggcac       840
     gccgtcgtgg cagtcggtaa tcccgatgcc gccgacaacg tcgcaacact ggttcccgga       900
     accggctccg ggctgtcggg cgtcggcgga gatctgcaac gaaccaaggc catgtacgac       960
     gcggcggtcg cggcggcgcc aacggaagcc acatcagtga tcctgtggtc cggatacgac      1020
     gctcccccag gcattcccga tgcagcctcg gatcggtacg ccaactccgc ggcgccgagg      1080
     ctggacagct tccaggacgg gttacgaacc tcgcatgacg gtcagccgtc gcacaacgtg      1140
     gtgatcggtc attcctacgg cagcaccgtc gtcggtgctg cgactacccg tggcgcttct      1200
     ctcgacgtcg acgaactggt ttttgtcgca agtccgggcg tcgatgtcga gcgtgtgaac      1260
     gaactgagcc tggacggcgt cgactcggac gaggtggcgc gccatgttca ttcgacgacg      1320
     gccttctggg atccggtcca attgatcccc aagatcctcg gagtccacgg gttcgacccg      1380
     tcggatccgg aattcggcgc gcagatattc gccggatcac ccgggcagcc tgggttcgga      1440
     gttcacagcg actactggga aagcagaaac cccgcactca ccgaattggg gcggatcatt      1500
     accggcccat ga                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page