(data stored in ACNUC1104 zone)

EMBL: AP008957.PE397

AP008957.PE397       Location/Qualifiers
FT   CDS_pept        444281..444694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31105"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN53"
FT                   /protein_id="BAH31105.1"
FT                   /translation="MTNLSNYEVGSTLPSLELPLDRTLIVATAIASQDFEDVHHDPGKA
FT                   QDRGTPDIFMSINTTNGLIDRYITDWSGPGSRIVKISLRLGVPNFPGDTMTFTGKVIDT
FT                   DGRTLTVTVLGKNARGTHVTADVTLEPAERVIA"
     atgacgaatc tttctaatta cgaggtaggt tcgacccttc ccagcctcga actgccgttg        60
     gaccgaacgc tcatcgtcgc cacggcgatc gcttctcagg atttcgagga cgtgcatcac       120
     gatccgggca aggcgcagga tcgcggaact cccgacatct tcatgagcat caacaccacc       180
     aacgggctca tcgaccgcta catcaccgac tggtcaggcc cgggatcgcg aatcgtcaaa       240
     atatcactac ggcttggtgt tccgaacttt cccggagaca ccatgacgtt caccggcaaa       300
     gtgatcgaca ccgacggccg gacgctcacc gtgacggttc tcggcaagaa cgctcgcgga       360
     acgcacgtga cagccgacgt gaccctcgaa ccggcggaaa gggtaatcgc atga             414
//

If you have problems or comments...

PBIL Back to PBIL home page