(data stored in ACNUC1104 zone)

EMBL: AP008957.PE398

AP008957.PE398       Location/Qualifiers
FT   CDS_pept        444691..445872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31106"
FT                   /db_xref="GOA:C0ZN54"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN54"
FT                   /protein_id="BAH31106.1"
FT                   /translation="MTRGFSRQAAIAGIGATEFSKNSGRSEWQLACESVIAALDDAHIE
FT                   AEEVNGFALFTMENNPEIAVARALGIPELTFFSRIPHGGGGACAPVQQAALAVASGVAD
FT                   VVVVYRAFNERSGHRFGAGPPPFAYNASTDQEYRNWINPYGLLTPAQQEAFLAKLYMHK
FT                   YGATSADFGQISVLSRKHAANNPKAWFYERPITIEDHQNSRMIADPIRLLDCCQESDGG
FT                   QALVIVSAERARDLPHKPAIISGAAQGVGPQQISMSSYYREDIDSMPEVELVARQLWDQ
FT                   AGIGPDDIDAAILYDAFTPMVLLQLEEYGFCGRGEAKDFIADGNLELDGRLPINTHGGQ
FT                   LGEGYIHGVNGIAEGVRLIRGTSTNQPTKTLDNVLVTGGSPVPHSALVLSADR"
     atgacacgag gattttcgag gcaagccgcc atcgccggga tcggcgccac cgagttctcc        60
     aagaactccg gtcgcagtga atggcagttg gcgtgcgaat ccgtgatcgc cgcgctcgac       120
     gacgctcaca tcgaggcaga agaggtgaac ggatttgcac tgttcaccat ggagaacaat       180
     cccgagattg cggtcgcacg cgctctcggg atcccggaac tgacgttctt cagtcgtatt       240
     ccccacggcg gcggcggcgc ctgcgcaccg gttcaacaag ccgcgcttgc cgtcgccagt       300
     ggtgtcgccg acgtcgtggt cgtctaccgt gccttcaacg aaagatcagg tcaccgattc       360
     ggcgccgggc caccaccctt tgcgtacaac gcgtcgacgg accaggagta tcggaactgg       420
     atcaacccgt acgggcttct gaccccggcg cagcaggaag ccttcctcgc caagctctac       480
     atgcacaagt acggggcaac cagcgccgac ttcggtcaga tctcggttct ctcacgcaag       540
     catgccgcga acaacccgaa ggcctggttc tacgaacgcc cgatcactat cgaggatcat       600
     cagaactcgc gcatgatcgc cgaccccatc cgtctgctcg actgctgcca ggaaagtgac       660
     ggtggacagg cgctggtcat cgtcagcgcg gagcgcgccc gcgacctgcc gcacaaacct       720
     gcgatcatca gcggtgctgc gcaaggtgta ggtccacaac agatttcgat gagcagctac       780
     taccgcgaag acatcgacag catgccggaa gtcgaactcg tggcgcgcca actgtgggac       840
     caggccggta tcggcccgga cgacatcgat gccgcaattc tctacgacgc cttcactccg       900
     atggttctgc ttcaactcga ggagtacgga ttctgcggtc ggggtgaggc aaaagacttc       960
     atcgccgacg gcaatctcga gctggacggt cgcctgccga tcaacaccca cggcggtcaa      1020
     ctcggtgagg gatacatcca cggcgtcaac ggtattgccg aaggtgttcg cctgatccgc      1080
     ggtacctcca ccaaccaacc caccaaaact ttggacaacg tgctcgtgac cggcggctct      1140
     cccgtcccgc acagtgcgct cgtcctctcg gcagatcgct ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page