(data stored in ACNUC1104 zone)

EMBL: AP008957.PE402

AP008957.PE402       Location/Qualifiers
FT   CDS_pept        449124..451334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31110"
FT                   /db_xref="GOA:C0ZN58"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN58"
FT                   /protein_id="BAH31110.1"
FT                   /translation="MALPLLEDHRDLAEAVAAFANRFGGIADTRSNVKRYAAGDRPDSW
FT                   DGLVRQGLHAVHLPEQYGGDGAGLAELAVVVEQLGDALYPGPYVPTVIASGILATAAGP
FT                   AAETMLTELAAGATGAVCTGTRLRAARSDAGWTVSGSADPALGLPGADVVLVRANSEDG
FT                   ELWFRLEPSTSAAVVIEDGVDLTRSIGTLTLTDHQVEAGLIVDGLQAHRTELIVNTVLA
FT                   AEASGIAGWALRTAVDYVKSRQQFGRPVGSFQAVQHKAAMMLVRSEIACAAAWDAARSE
FT                   EHDEDQQKLVSAQAALAALPVGIENALECVTLLGGIGFTWEHDAHLYWRRAISIAAVAG
FT                   SEVKWAHTLGDRSADSERDFSFVDPEMLPELREQVRRVLDEVALLPDDGTTSASWAPAK
FT                   GRARRARFADAKLVAPHYRAPYGLGAGPREQAVIAHEFAMRGWAQPSTVIGEWVLPTIL
FT                   EHGDAEQQDRFVEPSLRADIIWCQLFSEPGAGSDLAGLSTKARKVDGGWVLSGQKVWNS
FT                   GAHEADWGVCLARSDADAPKHRGLSYFLVDMTSKGVDVRPLKQATGKSEFNEVFLDEVF
FT                   VPDDCLVAEPGQGWKLAATTLSNERLSMGSTLHHGSSRLFRQVIADASHDCPREDAVEG
FT                   LGRSISRELALSAMNLRGVSARLAGQEPGAEISVSKVYNALAQREGSRDLLRLLGPRAA
FT                   VVDPSANYAIDHIGLPSILFGGGTVEIQLNVIAQRVLGLPRS"
     atggcactac ccctgctcga agatcaccgt gacctggcgg aagcggtagc cgcattcgcg        60
     aaccgcttcg gtggaatcgc cgatacgcgg agcaacgtca agaggtacgc cgccggtgat       120
     cggccggact cgtgggatgg gttggtccgt cagggcctgc acgcagtgca cctgccggag       180
     cagtacggcg gtgacggggc gggtcttgcc gaacttgcag tggtagtcga gcaattgggt       240
     gatgcgctct atccgggacc gtacgttccg acggtcatcg cgagcggcat tctcgcaaca       300
     gctgcgggcc cggctgcgga aacaatgctg accgaattgg ccgccggtgc aaccggagca       360
     gtctgcaccg gaacgagatt gcgcgcggct cgcagcgacg ctgggtggac agtgagcggt       420
     tctgccgacc cagctctagg tctgcccgga gctgatgtcg ttctcgtccg ggcgaacagc       480
     gaagacggcg agttgtggtt ccggctcgaa ccgtcgactt ccgctgcggt ggtgatcgaa       540
     gacggggtgg atctgacacg gtcgatcgga acactgacgt tgaccgatca ccaggtcgag       600
     gctgggctga tcgtcgacgg cctccaggcg caccgaaccg aactgatcgt caacacggtg       660
     ttggctgcgg aggcgagcgg tatcgccggg tgggcgctac ggaccgcagt cgactatgtg       720
     aagtcccggc agcagttcgg ccgtccggtc ggaagcttcc aggcagttca gcacaaggcg       780
     gccatgatgt tggttcggtc cgagattgcc tgtgccgcag cgtgggacgc cgctcgatcc       840
     gaagagcacg acgaggatca gcagaaactt gtctcggctc aagctgcgtt ggccgctttg       900
     cccgtcggca tcgagaacgc cctcgaatgt gtaactttgc tcggcggaat cggattcact       960
     tgggagcatg acgcgcatct gtactggcgc cgggcgatca gtatcgcggc agtggcgggt      1020
     tccgaggtga agtgggcaca cacattggga gaccggtccg ccgattcgga acgggatttc      1080
     tcctttgtcg acccggaaat gctgccggag ttacgagagc aggttcggag ggttctggac      1140
     gaggttgcgc tgctgcctga cgacggaacc accagcgcga gttgggcgcc ggccaagggg      1200
     cgcgctcgac gcgcccgatt tgccgacgcc aaactggttg ccccgcacta tcgggcgccg      1260
     tacgggctcg gagcggggcc gagggaacag gccgtcatcg cacatgaatt cgcgatgcga      1320
     ggttgggctc aaccgtccac ggtgatcggg gaatgggtgc tgcccacgat tctcgaacac      1380
     ggcgacgccg agcagcagga caggttcgtc gagccttcgc tgcgcgccga catcatctgg      1440
     tgccagctgt tcagtgagcc gggcgcggga tcagacctgg ccggtctgag cacgaaagcg      1500
     cgcaaggtcg acggtggctg ggtcctgtca ggtcagaaag tgtggaactc gggtgcgcac      1560
     gaggcagatt ggggagtatg cctggcgcgt tccgacgcgg acgctccgaa gcatcgtggg      1620
     ctgtcgtact tcctggtcga catgacctcg aagggcgtcg acgtacgtcc gctgaagcaa      1680
     gccaccggca agtcggaatt caacgaggta ttcctcgacg aggtcttcgt cccggacgac      1740
     tgcctggtgg ccgaacctgg gcaagggtgg aaactggctg cgacaacgct gtccaacgaa      1800
     cgcttgagca tgggcagcac gctgcaccac ggttcgagtc ggttgttccg tcaggtgatt      1860
     gccgacgcga gccacgactg cccccgcgaa gatgcagtgg aaggcctcgg ccgcagtatc      1920
     tctcgtgagt tggcactgtc cgcgatgaat ctgcgcggag tgtcggcgcg actggcgggt      1980
     caggaaccgg gcgccgagat cagcgtgtcg aaggtgtaca acgccctggc gcagcgcgag      2040
     ggctcgcggg acctgttgcg actgctcgga ccgcgcgccg cagttgtcga cccgtcggcg      2100
     aattacgcga tagaccacat cggacttccc tcgattctgt tcggcggcgg aaccgtcgaa      2160
     atccaactca acgtcatcgc gcagcgcgta ctcggcctgc cgcgttcgta g               2211
//

If you have problems or comments...

PBIL Back to PBIL home page