(data stored in ACNUC1104 zone)

EMBL: AP008957.PE405

AP008957.PE405       Location/Qualifiers
FT   CDS_pept        453753..454916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04050"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31113"
FT                   /db_xref="GOA:C0ZN61"
FT                   /db_xref="InterPro:IPR010640"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN61"
FT                   /protein_id="BAH31113.1"
FT                   /translation="MNRTSSFIRPLVPRDPHEPHRVATPLELLTDLCFVVAVAQAATGL
FT                   HHAISEGHAASGVGHFAMAFFAIWWTWLNFTWFTSAYDNDDGIARLLTIFQILGSLVLA
FT                   AGIVRFFNDDALLIIVGYVIMRIALVIQWLRVSRNDPEHALTARRYALGIVLVQIGWIG
FT                   FYFVPSAIYVPTFLVLVLCEFAVPIWSEKPGMTPWHPHHIAERYSLFFIIVLGETILST
FT                   TIAIQDAVDGEHPAAQVTYVVIGGILIVFSLWWLYFQRNAGEVIGGDNVSPFVWGFGHY
FT                   FIFAAAAAIGAGLASRVDFWTHHGDGSALVTGAAVTVPVAVILAALWFIHIRLHDSSVR
FT                   TLMPFSVAIVVVLGGTYTAVPELVAGLACAALLAVELVLTEGKSETV"
     gtgaatcgca ccagttcgtt catccggccg ttggttccgc gggatccgca cgagccgcat        60
     cgggtggcga cgccgctcga gctgctcacc gacctctgct tcgtcgtggc ggtcgctcaa       120
     gcggccaccg gtctgcacca cgcgatcagc gaagggcacg cggcttcggg cgtcgggcac       180
     ttcgcgatgg cgttcttcgc gatctggtgg acgtggctga acttcacgtg gttcacctcg       240
     gcgtacgaca acgacgacgg aatcgcccgg ctgctgacca tcttccagat cctcggatcg       300
     ctggtccttg cagccggcat cgtccgcttc ttcaacgacg acgccctgct catcatcgtc       360
     ggctacgtca tcatgcgaat agccctggtc atccaatggc tcagggtgtc gcggaacgac       420
     cccgaacatg cgctcacggc tcgtcgatac gctctcggaa tcgtgttggt ccagatcggt       480
     tggatcggtt tctacttcgt tccgtccgcc atttacgtcc cgacgttcct ggtgttggtt       540
     ctgtgcgaat tcgcggtacc gatctggtcg gagaagccgg gcatgacgcc gtggcacccg       600
     catcacatcg cggagcggta ctcgttgttc ttcatcatcg ttctgggcga gacgatcctt       660
     tcgaccacca tcgcgattca ggacgcggtc gacggtgagc atccggcagc gcaggtcacc       720
     tacgtcgtga tcggcggcat tctgattgtc ttcagcctgt ggtggctcta cttccaacgt       780
     aatgcaggcg aagtgatcgg cggtgacaac gtctcaccct tcgtctgggg gttcggtcac       840
     tacttcatct tcgccgccgc tgccgccatc ggtgcggggt tggcttcgcg cgtcgacttc       900
     tggactcatc acggtgacgg cagcgcgttg gtgacgggtg ctgccgtcac cgttccggtc       960
     gcggtcatcc ttgccgccct gtggttcatc cacattcgac tacacgactc ctcggtacgc      1020
     accctcatgc cgttctcggt cgcgatcgtc gtcgtgctcg gtggtaccta caccgcggtg      1080
     cccgaactgg ttgcgggact ggcctgcgcc gcgctgttgg ccgtggaact ggttctgacc      1140
     gaggggaaat ccgaaaccgt ctga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page