(data stored in ACNUC1104 zone)

EMBL: AP008957.PE408

AP008957.PE408       Location/Qualifiers
FT   CDS_pept        complement(456908..457849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04080"
FT                   /product="probable amino acid efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31116"
FT                   /db_xref="GOA:C0ZN64"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN64"
FT                   /protein_id="BAH31116.1"
FT                   /translation="MTPRDRLLGLTVIVLWGLNFLAIRVGLDHFPPFFFAALRFLIIAI
FT                   PVVIFVPRPQVPLRWLLLYGFGFGFGQFVFLFWAMHSGMPTGLASLVLQSSAPFTVLLG
FT                   AFLLREKLSVWQVSGIAVAVVGMSLIGWDRSHHAALLPVILTLLGGLSWAFGNLGSRLA
FT                   AANTVGEPAPMRLMLWMCVIPPLPMLALSAVVEGPTAGWHALGTAFSADAWPSLVGLAY
FT                   IILLGTIAGSGLWTMLMGRYPAGMVAPLSLLVPVVGIGASGLFLHEDPSPLSLVGAVIV
FT                   IAGASAAQMRRKPANTVFSDTPAASPPARLGV"
     atgactcccc gcgaccgtct cctcggcctg accgtgatcg tcttgtgggg tctgaacttc        60
     ctggccattc gcgtcggcct ggatcatttc ccgccgttct tcttcgctgc actccggttt       120
     ctgatcatcg cgattccggt ggtcatcttc gtgccgcgtc cgcaggtacc gctccgttgg       180
     ttgctgctct acggattcgg tttcggattc ggccagttcg tcttcctctt ctgggcgatg       240
     cattcgggga tgccgacagg tctcgcatca ctggtcctgc agtcgtccgc gccgttcacc       300
     gtcctactcg gcgcgttcct gctccgcgag aagctcagcg tctggcaggt ctccgggatc       360
     gccgtcgccg tagtcggtat gtcgttgatc ggctgggacc gttcacacca cgcggcactg       420
     ctgcccgtga tcctcacgct cctcggcggc ctgtcctggg cgttcggcaa tctcggcagc       480
     cgcttggccg cggcgaacac cgtcggcgag cccgcaccga tgcgcttgat gctgtggatg       540
     tgcgtcatcc cgccgttgcc gatgctcgcc ctgtcagcgg tggtcgaagg ccccaccgcc       600
     ggatggcacg cgctcggcac cgcgttcagc gccgacgcct ggccgtcact ggtcgggctg       660
     gcctacatca ttctgctcgg caccatcgcc ggatccgggc tctggacgat gctcatgggc       720
     cgctatcccg ccggcatggt ggcgccgctc tccttgctgg taccggtagt gggaatcggc       780
     gcatccgggc tgttcctgca cgaggatccg agcccgttgt ccctggtcgg ggcagtcatc       840
     gtgatcgccg gagcgagtgc cgcacagatg aggcgcaagc ccgcgaacac tgttttctcg       900
     gacacacctg cagcctcacc accggcgcga ctcggcgtct ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page