(data stored in ACNUC1104 zone)

EMBL: AP008957.PE41

AP008957.PE41        Location/Qualifiers
FT   CDS_pept        complement(48881..50047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30749"
FT                   /db_xref="GOA:C0ZLI1"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLI1"
FT                   /protein_id="BAH30749.1"
FT                   /translation="MDEQQVKPSQPLNLKWRLIIALHMLHFFSILEHDALRAKLGKSKD
FT                   DSNQLSAFSNADFIKYFEDEFNFEGLFHRSSQLRAISASLERAGFLDRVPGGSPMFPAY
FT                   WETPHLTTAAQISGLLWLSPVLGSEFIIRSFGASTIAITGTNKSTGEMSTGTGILLDSQ
FT                   HVLTNKHVVEDMKLAVELMSSSIADPLCTSEIAEQRILRVVKQSAHEKIDVGIIEIEPV
FT                   EGEEPIDPVKGIAFRDPFWEDDTWTFGYPRVPLARDPAPLVVHKGAVVSPRVLDFFGNE
FT                   FFLFSSTSRPGNSGGPIVAEDGRVVGIVTRSLEVDDGPGSAAISDSNGTRVDETTKESA
FT                   STSWNGGISAAPFYAGIPTNSIEKALADMGYPNLLNVERWDLPTHNHD"
     atggatgaac aacaggtgaa accttcccaa cccttgaacc tgaaatggcg cctgatcatt        60
     gctttgcaca tgctgcattt cttctcgatc ctagaacacg acgcattgcg ggcgaagctg       120
     ggaaaatcca aggacgattc caatcagctg tcagcgtttt cgaacgcgga tttcataaag       180
     tatttcgaag acgagttcaa ctttgaggga ctattccatc gctcatctca gctcagggct       240
     atctcagcgt ctttggaacg cgctggattt cttgatcgcg tgcccggcgg atcacctatg       300
     ttccccgctt attgggagac tccccacctg accactgcgg cacagatttc tgggcttttg       360
     tggctttctc ccgtgctcgg ctcagagttc ataatccgtt cgttcggcgc ttccacgatc       420
     gcaatcaccg gaacaaacaa gtccacggga gaaatgtcga cggggacggg cattcttctc       480
     gattctcagc atgtgctgac taataagcat gtggttgagg atatgaaact cgctgtcgaa       540
     ttgatgtcct cctcaatcgc agaccctttg tgtacgagcg aaattgctga acaacgaata       600
     ctgcgagtgg taaaacagtc agcgcacgag aagatcgatg tcggcatcat cgagatcgaa       660
     cctgtcgagg gagaggaacc gatcgatccc gtcaaaggga tcgcgttccg cgatcccttc       720
     tgggaggacg acacttggac attcgggtat ccccgggttc cgctcgcgcg agatcctgcg       780
     ccgctggtgg ttcataaagg cgctgttgtc agcccgcgtg tattggattt ctttggaaac       840
     gagtttttct tgttttcgtc aacttcgagg ccgggaaaca gcggtgggcc gattgtcgct       900
     gaagacggcc gtgttgtcgg tatcgttacg cggtcgctgg aagtcgatga cggacctggc       960
     tccgcggcca tctcagactc caatgggacg cgggtggacg aaacgacgaa ggagtccgcg      1020
     tcgacaagct ggaacggcgg catctcggct gcacccttct acgcgggtat tcctactaac      1080
     tcgattgaga aagctctcgc agatatggga tatccgaatc tgttgaatgt agaaagatgg      1140
     gatctgccga cgcataatca cgattag                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page