(data stored in ACNUC1104 zone)

EMBL: AP008957.PE412

AP008957.PE412       Location/Qualifiers
FT   CDS_pept        461508..461999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31120"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN68"
FT                   /protein_id="BAH31120.1"
FT                   /translation="MRAACTALYSWISREIGGVRPHVQFVAELCCRFGLENGGLSSMDP
FT                   RIAVASTYLDALRSHDGSSVPLAPDAVRHEVGLKTGFSGNHLRRSLSGGPQYRVIRDIR
FT                   EVEWTVDGDDLTADYLLDAGLFGRNLMTVRVTETFRIPADDHRIHHITAKIRPARAKHT
FT                   "
     gtgcgcgctg catgcacagc actctactcc tggatttcgc gagaaatcgg tggggttcgc        60
     cctcatgtcc aatttgtcgc cgaattgtgc tgccgtttcg gcctcgaaaa tggtggactg       120
     tcgtccatgg atccccgaat cgccgtggcg agcacgtacc tcgacgcgct ccgtagtcac       180
     gatggcagtt ccgtaccgct ggctccggac gcggtacgtc acgaggtcgg gttgaagacc       240
     ggattttcgg ggaatcattt gcggcgcagc ctttccggag gtcctcagta tcgcgtgatc       300
     cgcgacattc gtgaggtgga gtggacggtc gacggggacg acctgacggc tgactacctc       360
     cttgacgccg ggttgttcgg gcgcaacctg atgaccgttc gggttaccga gaccttccgg       420
     atacccgctg acgatcaccg cattcaccac atcaccgcga agattcgacc ggcgcgcgcc       480
     aagcacacgt ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page